SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015960 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015960
Domain Number 1 Region: 357-748
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.14e-128
Family Oxysterol-binding protein 0.0000335
Further Details:      
 
Domain Number 2 Region: 103-223
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-24
Family Pleckstrin-homology domain (PH domain) 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015960   Gene: ENSOARG00000014876   Transcript: ENSOART00000016193
Sequence length 848
Comment pep:known_by_projection chromosome:Oar_v3.1:3:112160894:112265105:-1 gene:ENSOARG00000014876 transcript:ENSOART00000016193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRQGKEAFPTPTKDLYQPSFSPASPHTPGFERGKEDISQNKDESSLSMSKSKSESKLY
NGSEKDSSASSKLTKKESLKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLK
SWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWA
VKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHD
LSISSESTHVTLYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDES
DNEVMGKSEESDTDTSERQDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEE
NKSLIWTLLKQVRPGMDLSRVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRL
KRVVKWYLSGFYKKPKGLKKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFY
VSNRKDGFCLSGSILAKSKFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGT
MTLELGGTVSITCQKTGYSAVLEFKLKKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDS
EVFITDKKTDNSEVFWNPTPDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTE
ATQEKYVLEEAQRQAARERKTKNEEWTCRLFELDSLTGEWHYKFADTRPWDPLNDMIQYE
KDGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSARR
KKGIELGDIQTSIESIKQTQEEIKRNIMALRNHLISSTPATDYFLQQKDYIIIFLLILLQ
VIINFMFK
Download sequence
Identical sequences W5PZS4
ENSOARP00000015960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]