SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016136 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016136
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000302
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016136   Gene: ENSOARG00000015039   Transcript: ENSOART00000016370
Sequence length 208
Comment pep:known_by_projection chromosome:Oar_v3.1:9:69121382:69157325:1 gene:ENSOARG00000015039 transcript:ENSOART00000016370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISFSLAYFMILFLPARDFYPRCQGCRKFLWQRAGYVSNPICKGCLSCSKDNGCSRCQQKL
FFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYL
HRGRCFEECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKK
PAKDTIPCPTIAESRRCKMAMRHCPGGE
Download sequence
Identical sequences W5Q0A0
ENSOARP00000016136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]