SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016558 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016558
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 3.27e-27
Family ENV polyprotein, receptor-binding domain 0.00092
Further Details:      
 
Domain Number 2 Region: 414-457
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0000000000211
Family Virus ectodomain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016558   Gene: ENSOARG00000015436   Transcript: ENSOART00000016794
Sequence length 457
Comment pep:novel chromosome:Oar_v3.1:3:122330135:122331594:1 gene:ENSOARG00000015436 transcript:ENSOART00000016794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STDPHQPVKITWRLQNGLMREVLNTTTETHPPNTWWPDLYFNLKDLVDTPWSVPLIRYRG
FWACPGHKSDRETCGGIQHYFCRSWRCVTSNDGVRKWKTSNFSFTQPLPRDESEFYDQED
EIPKDEIAQKLAMQEKSWVSGLSWGFQLQADGFSVNPGGILIVSQIIEPIQTQSVGPNQI
ENPGPQRVFKADPTQRATILSPTPSVSRPGGQPNIAEALDPLSSTSNLEDLAKAAFKALN
DSNPRATQSCWLCYTLYPPFYEAIGLDVSYNLSTSSGPPQCHWRKHRVSLTMKEVWGRGL
CLGKVPLEKTPSCARTVNLTELDQIKRIAPKAGGWWADSVFNPNREFCVLVTVMPKIHPE
EAMYDYWAKETIDQLGKDRVKREPITTITLANMFGLRIAGAGTRITSLTMQNQAAIDKDI
TRIEQSISHLEESLTSLSEIVLQNRRGLDLISLHQGG
Download sequence
Identical sequences W5Q1H0
ENSOARP00000016558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]