SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016851 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016851
Domain Number 1 Region: 132-190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000115
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 2 Region: 34-142
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000273
Family Link domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016851   Gene: ENSOARG00000015700   Transcript: ENSOART00000017090
Sequence length 623
Comment pep:known_by_projection chromosome:Oar_v3.1:19:7416598:7462160:-1 gene:ENSOARG00000015700 transcript:ENSOART00000017090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGPGPGARLWAAALLLLGLPRLSTPANGKLFVLESQNGSQGLALEAARLSCRSRGAH
LVSADELRRVVQDCALAVCTGRHPRAAALSTTVCSKGRGEQQAVRAVDVRVESSPVPGGT
YNALCIKDEEKPCGDPPSFPHTILQGRTGLEMGDELLYVCAPGHVTGQRETAFTLLCDSC
GEWYGLVQACGKDEAAVHIDYEDNFPDDRSVSFRELMEDSRTEAEDRSQGEPSEEAPKQD
RLVSMPVAREDRAQDTGFVPTTGLLGAGSPVPTELPGSQGSGKDVLWSPAGTFHKPEWEK
EMDDDAKKHLPAADHHRGSTLAPGEPETRVVYHSTDGPSGPPVGRNDSRAGDAMVSSSDE
SWLDGYPVTDGAWRQTEAGEEEDEEEEDKGNGSARLEASMLITPSQPALAGRKGSRSTAR
TPSEDVTSLLPSQTLDGEALALRPMNVSETEGPGKGAGDLTGNQSTVPWRYAAEKPPTST
LPYELTSSTLETETTAVQKTPSLTPSTVVAATQTPLETTAPAVQDTFPYLLSEDFLGQEV
PGPGASEELLPTLEPCAGGKCPSLGRGPIVATVVTVLCLLLFLAGVGAVWGYRRCQHKSS
VYKLNVGQRQARHYHQQIEMEKV
Download sequence
Identical sequences W5Q2B3
ENSOARP00000016851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]