SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017953 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017953
Domain Number 1 Region: 47-205
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 2.62e-31
Family ENV polyprotein, receptor-binding domain 0.00066
Further Details:      
 
Domain Number 2 Region: 466-539
Classification Level Classification E-value
Superfamily Virus ectodomain 2.5e-21
Family Virus ectodomain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017953   Gene: ENSOARG00000016715   Transcript: ENSOART00000018204
Sequence length 544
Comment pep:novel chromosome:Oar_v3.1:2:125437479:125440270:1 gene:ENSOARG00000016715 transcript:ENSOART00000018204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERMGSISAPVQPPEAKASKAPTGPGQLGWALLWMTQLLCSGVASVNPHQPVKITWKLQNG
LTREVLNSTTAIHPPNTWWPDLYFDLKPMVNVPWARGYLREQGFWACPGAPRHDWKTCGG
AQDSYCKTWDCVTSNDGPRRWEVGNRDLLNFSFAKPLPRVLGDPTFSCESCNYAQVRIRF
NPEKSKKEGTWISGLSWGLQTRESGGFGVDGKGIIVVSQVLEPILVHSIGPNKVEKLAVT
PRLTTSMPTSLAVSPEAEALAEIDPLWKLIRAAYATLNQTHPEATKSCWLCYNLIPPYYE
AVGLNASYDLANSTDPPQCHWGDRKVGLTMKEVWGKGLCMGTVLPAKSPLCVHVVEPDDL
PVAKWLIPQMGGWWVCSHTGLTPCLHSSIFDPKEEFCVMVAVMPKILYRPEKAIYDYWAQ
KLTLNPPKRTYKVKREPLTVITIATMFGLGIAGAGTGITALSLQGQGFNSLRAAIDEDIT
RIEQSISHLESSLTSLSEVVLQNRRGLDLLFLQQGGLCLSIFKKCSWFRTHTNSIEINLS
KMSD
Download sequence
Identical sequences W5Q5G3
ENSOARP00000017953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]