SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018218 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018218
Domain Number 1 Region: 460-706
Classification Level Classification E-value
Superfamily vWA-like 8.89e-71
Family Trunk domain of Sec23/24 0.0000988
Further Details:      
 
Domain Number 2 Region: 220-477
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.28e-36
Family beta-sandwich domain of Sec23/24 0.0043
Further Details:      
 
Domain Number 3 Region: 708-803
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-36
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 4 Region: 910-1051
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.75e-32
Family C-terminal, gelsolin-like domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 804-909
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 7.32e-29
Family Helical domain of Sec23/24 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018218   Gene: ENSOARG00000016964   Transcript: ENSOART00000018477
Sequence length 1055
Comment pep:known_by_projection chromosome:Oar_v3.1:6:6662392:6777153:1 gene:ENSOARG00000016964 transcript:ENSOART00000018477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCLFPSVTGFFYRTVPWNDIFIMSQQGYVATPPYSQSQPGIGLSPPHYGHYGDPSHAGS
PPGMIKPAGPLGAAPPGGVLPQGHPPPGPHQFGQNGAHAQGPPPQRFPGPPPVNSAAPSY
PPYSPSTQSSYPSPGSASSITQLGSQLNAMHVNSYGSGVAPPSQGPPGPASAASFQGPPQ
PPQPSILQPGSQILPPPPTALNGPGVSALPPSTHRPDGLPGPAPPNAQYQPAPLPGQNLG
PGYPAQQANYGPPVAGAQLSYPGGFPGGPAQMAGPPQPQKKLDPDSVPSPIQVIESDRAA
RGGQVYATNARGQIPPLVTTDCVIQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAII
KPFATIPSNETPLYLVNHGETGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNDVPPF
YFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGL
VKLICEELKTVLEKLPKEDQEETSAIRVGFITYNKVVHFFNVKSNLAQPQMMVVTDVSEV
FVPLLDGFLVNYQESQSVIHNLLDQIPEMFADSNENETVFAPVIQAGMEALKAADCPGKL
FIFHSSLPTAEAPGKLKNRDDKKMINTDKEKILFQPQTNVYDSLAKDCVAHGCCVTLFLF
PSQYVDVASLGLVPQLTGGTLYKYNGFQMHLDSQQFLNDLRNDIEKKIGFDAIMRVRTST
GFRATDFFGGIYMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDTGALIQCAVLYTTVSGQ
RRLRIHNLGLNCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHML
ACYRKNCASPSAASQLILPDSMKVLPVYMNCLLKNCVLLGRPEISTDERAYQRQLVMTMG
VADSQLFFYPQLLPIHTLDVKSTTLPAAIRCSETRLSEEGIFLLANGLNMFLWLGVSSPP
ELIQGIFNVPSLAHVNTDMTLLPEVGNPYSQTLRMIMGIIQQKRPYSMKLTIVKQREQPE
MVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
Download sequence
Identical sequences W5Q678
XP_004009640.2.66739 ENSOARP00000018218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]