SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018750 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018750
Domain Number 1 Region: 93-250
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-27
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 2 Region: 255-363
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.28e-21
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 498-543
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000866
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 563-595,629-694
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000589
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018750   Gene: ENSOARG00000017466   Transcript: ENSOART00000019016
Sequence length 744
Comment pep:known_by_projection chromosome:Oar_v3.1:3:215718995:215726718:1 gene:ENSOARG00000017466 transcript:ENSOART00000019016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGSHVPSANGPFSALTPSMWPQEILAKCAQEEAAEEQPEVRYDEFGFRVDKEDADGTPY
SGQLLEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGVPHSMRPQL
RMLLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFAHVSGVGVPR
LRRVLRALAWLYGAGGWHMVCGVVAACLLLFLEEDDAFWMMCAIIEDLLPASYFSTTLLG
VQTDQRVLRQQPARRVLRHLIVQYLPRLDRLLQEHDIELSLITLHWFLTAFASVVHIRLL
LRLWDLFFYEGSLVLFQATLGMLRLKEDELIQSENSASIFNTLSDIPSQLEDADLLLAEA
MRLAGSLTALAVEAQRRKHLAYLLADQGQLLGPPQPASLSQVVRRRTQRRKAGITSLLFG
GRALGWALKVWGMCTRNHSPGSVHKGGVVEGRRHCQFTDPNNCNGELTPDYSMESHQRDH
ENYVACSRGHPRRATALELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDAVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREV
ERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICV
GLNEQVLHLWLEVLCSSLPTVEKWYQPWAFPRSPGWVQIKCELRLQCGFHSLCPAAVTEE
KKPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences W5Q7Q8
ENSOARP00000018750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]