SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019006 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019006
Domain Number 1 Region: 1570-1812
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.57e-54
Family Ankyrin repeat 0.00000125
Further Details:      
 
Domain Number 2 Region: 474-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000014
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 343-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 156-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000688
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 586-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 6 Region: 924-1048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 7 Region: 764-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000025
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 8 Region: 276-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000871
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 103-236
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 235-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000518
Family EGF-type module 0.019
Further Details:      
 
Domain Number 11 Region: 688-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 1244-1275
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.0024
Further Details:      
 
Domain Number 13 Region: 807-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 14 Region: 1039-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000456
Family EGF-type module 0.014
Further Details:      
 
Domain Number 15 Region: 726-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 65-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1207-1237
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 18 Region: 30-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000019006
Domain Number - Region: 312-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000725
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1125-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000797
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1166-1195
Classification Level Classification E-value
Superfamily Notch domain 0.00248
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 623-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00907
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019006   Gene: ENSOARG00000017704   Transcript: ENSOART00000019274
Sequence length 1987
Comment pep:known_by_projection chromosome:Oar_v3.1:20:26301244:26326080:1 gene:ENSOARG00000017704 transcript:ENSOART00000019274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSPLLLPLLLLLCWPVVRTRGLQCGSFPEPCANGGTCLSLSQGQGTCQCAPGFLGET
CQFPDPCQDAQPCQNGGSCHTFLPTLPGSPGIPSPTAPSFFCTCPSGFTGDRCQAQIKDP
CSSFCSKMGRCHLQASGRPRCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCRC
PPGFEGHACEHDVNECYLDPGPCPKGTICHNTLGSFQCLCPAGREGPRCGLRPGPCTPRG
CLNGGTCQLVPGRDSTFHLCLCPPGFTGPSCEVNPDDCVGHQCQNGGTCQDGLGTYTCLC
PEAWTGWDCSEDVDECEVQGPPRCRNGGTCQNSAGDFHCVCVGWGGAGCEENLDDCVAAT
CAPGSTCLDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHEEAQCSTNPLSGSTLCVCQPG
YTGPTCHQDLDECQMAQQGPSLCEHGGSCLNTPGSFECLCPPGYTGSRCEADHNECLSQP
CHRGGTCLDLLATFQCLCPPGLEGRLCEVEVNECASAPCLNQADCHDLLNGFRCICPPGF
TGPRCEEDINECQSSPCANGGECQDQPGSFHCKCPPGFEGPRCQEEVDECLSGPCPTGAS
CLDLPGAFLCICPSGFTGHLCEIPLCAPNLCQPKQKCKDQEDSAHCLCPDGNPGCAPTED
NCTCHHGHCQRSSCVCDGGWTGPECDTDLGGCVSTPCAHGGTCHPQPFGYNCTCPTGYTG
PTCSEEVTACHSGPCLNGGSCSPSPGGYSCACPLSHTGLRCQTSIDHCASAPCLNGGTCV
NRPGTSSCLCAPGFQGPRCEGRTRPSCADSPCQPSAECQDSPQGPRCLCPPGYTGGSCQT
LMDLCAQKPCPQNSHCLQTGPSFQCLCLQGWTGPLCNLPLSSCQRVALSQGTEVSSLCQN
GGVCIDSGPSHFCHCPPGFQGSTCQDQVNPCESRPCQHGATCVAQPNGYLCQCAPGYSGQ
NCSKEPDACQSQPCHNQGTCTSKPGGFHCACPPGFVGLRCEGDVDECLDRPCHPTGTAAC
HSLANAFYCQCLPGHTGQWCEVELDPCQSQPCAHGGSCEATAGTPPGFTCHCPQGFEGPT
CSHRAPSCGLHHCHHGVLCLLPPRCACLNGYGGPDCLTPPAPSGCGPPSPCLHNGSCSET
PGLGGPGFRCSCPASSPGPRCQRPGVKGCEGRSGDGACDAGCSGPGGNWDGGDCSLGVPD
PWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCRDHFHNGHCE
KGCNTAECGWDGGDCRPEDRNSEWGPSLALLVVLSPSTLDQQLLALARVLSLTLRVGLWV
RKDSEGRDMVYPYPGAQAEEELGGTPDPSQQERAAPQTEPTGKETDSLSTGFVVVMGVDL
SRCGPEHPASHCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTEPSANQLPWPV
LCSPVVGVLLLALGALLVLQLIRRKRREHGALWLPPGFTRRPRTQPVSRRRRPPLGEDSI
GLKALKAEAEMDEDGVVMCSVPKEGEEVGQAEEMASPPKCQLWSLSSDCQELPQAAMLTP
PQDSEMDVPDVDTQGPDGVTPLMSAVCCGGVESRTYQETWLGSPEPWEPLLEGGACPQVH
TVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLRS
RQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARA
ARSLLQAGADKDAQDGREQTPLFLAAREGAMEVAQLLLGLGAARGLRDQAGLTPGDVARQ
RNHWDLLTLLEGAGPPEARHKPTPGRGAGTFQRARTASGSVPPRGGGAAPRCRTLSAGAR
PQARTLSVDLAAHGGGVYSHCRSLSQETGEGPPLRGRRFSAGMMRGPRPNPAIVRGRSGV
SAGSGGVAAAVDWPCDWVALGACGSASNTPIPPPCLTPSPERGSPQVAWGPPAPQVIPLN
AGGEGQK
Download sequence
Identical sequences W5Q8G4
ENSOARP00000019006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]