SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019252 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019252
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000326
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019252   Gene: ENSOARG00000017937   Transcript: ENSOART00000019520
Sequence length 447
Comment pep:known_by_projection chromosome:Oar_v3.1:24:36287233:36293732:1 gene:ENSOARG00000017937 transcript:ENSOART00000019520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADRVSQEPQALLESTLPSSKGPAFSDKGGLGDEMLAAALLKAKAQELVTFEDVAVY
FIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTEPDSEISEDRGSHGVLLGRFQKD
ISQGLKFEEAYEQEVSLKRQLGSSSGERLNRKMQEFGQVAAEEQRAPTGGRSEKCGDLRD
SFTVGANLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVMGVSKSSLQVTAEVNIREST
Download sequence
Identical sequences W5Q960
ENSOARP00000019252 XP_004021088.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]