SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019593 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019593
Domain Number 1 Region: 495-753
Classification Level Classification E-value
Superfamily NHL repeat 3.4e-47
Family NHL repeat 0.00000872
Further Details:      
 
Domain Number 2 Region: 333-429
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 44-88
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000754
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Domain Number 4 Region: 134-179
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000163
Family B-box zinc-binding domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000019593
Domain Number - Region: 173-258
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0667
Family Apolipoprotein A-I 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019593   Gene: ENSOARG00000018257   Transcript: ENSOART00000019866
Sequence length 755
Comment pep:known_by_projection chromosome:Oar_v3.1:15:45990038:46006695:1 gene:ENSOARG00000018257 transcript:ENSOART00000019866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPPVGTMAKREDSPGPGCEWQEPPVGTMAKREDSPGPEVQPMDKQFLVCSICLDRYRCP
KVLPCLHTFCERCLQNYIPAQSLTLSCPVGVSALQNNFFISSLMEAMQQAPDGAHDPEDP
HPLSAVAGGPPSLCRQTMEFYCEACETAMCGECRAGEHREHGTVLLLRHKAALQRQLEAV
RGRLPQLSAAIALVGGISQQLQERKAEALAQISSAFEDLEQALQQRKQALVSDLEAICGA
KQKVLQTQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPER
PHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKD
KDGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPV
RGSPFRVRALRPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIE
DELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRS
PGQLQRPTGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHI
IVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVY
SADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTS
AEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ
Download sequence
Identical sequences W5QA50
ENSOARP00000019593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]