SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020606 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020606
Domain Number 1 Region: 827-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000893
Family Laminin-type module 0.0000555
Further Details:      
 
Domain Number 2 Region: 723-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000893
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 885-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family Laminin-type module 0.00017
Further Details:      
 
Domain Number 5 Region: 936-986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 6 Region: 446-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 772-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000398
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 9 Region: 341-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 10 Region: 984-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020606
Domain Number - Region: 1076-1281
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00048
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 
Domain Number - Region: 1283-1527
Classification Level Classification E-value
Superfamily Tropomyosin 0.000608
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number - Region: 99-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00196
Family Galactose-binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020606   Gene: ENSOARG00000019180   Transcript: ENSOART00000020889
Sequence length 1610
Comment pep:known_by_projection chromosome:Oar_v3.1:12:62163057:62283591:1 gene:ENSOARG00000019180 transcript:ENSOART00000020889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSDPAAAALRSWGRFWPVLVVLAAAVAGCARAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWTPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECQPCDCNGRSQECFFDPELYRST
GHGGHCTNCQDNTDGAKCERCRENFFRLGNREACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFETDEDGWRAEQRDGSEASFEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNFSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCELCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSFDCQPCPCPGGSSC
AVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGSNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKAVACDCNPYGTVKQQSSCN
PVTGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIHSGQCECQPG
ITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENY
FYNRSWPGCQECPACYRLVKDKVADHRARLRELESLIANLGTGDEMVTDQAFEDRLKEAE
REVTDLLREAQDVKDVDQNLMDRLQRVNNTLFSQISRLQNIRNTIEETGNLAEQARSRVE
STEQLIEIASRELEKAKVAIANVSVAQPESTGDPNNMTLLAEEARKLAERHKQEADDIVR
VAKTANDTSAEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKK
AGDKAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMRGKEF
EVKNLLEKGKTEQQTADQLLARADAAKALAEEAAEKGRNTLQEANDILNNLKDFDRRVND
NKTAAEEALRRIPAINQTIIEANEKTREAQQALGNAAADATEARNKAHEAERIASAVQKN
ATSTKADAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQEDADQDMMMAGMASQAAQEA
EINARKAKNSVTNLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKEEMKVSDLDRKVS
NLENEARKQEAAIMDYNRDIEEILKDIRNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences W5QD08
ENSOARP00000020606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]