SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020905 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020905
Domain Number 1 Region: 8-170
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-40
Family RUN domain 0.0023
Further Details:      
 
Domain Number 2 Region: 425-464,514-566
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000158
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000020905
Domain Number - Region: 394-513
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020905   Gene: ENSOARG00000019464   Transcript: ENSOART00000021197
Sequence length 571
Comment pep:known_by_projection chromosome:Oar_v3.1:2:219139915:219158970:1 gene:ENSOARG00000019464 transcript:ENSOART00000021197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEGAVLKMTRDLKAAVSAILQGYGAGRQPVTDASAELHRLCGCLELLLQFDQKEQKSF
LRPRKDYWDFLCAAPGRPALACPSAHLSPMHSQLKTPLGKGRAFIRFCLAHGQLAESLQL
CLLNPEFTREWYGPRSPLVCPELREDILDSLYALNGMTFDLDLQRPDLDGAWPMFSESHC
SNSSRTQGRRPRKTKGSPKEISATHGNSTEVHLEEPHTSQASCLQDAPRKDGLAGLPRSQ
QHRHHPPFLEKKKEDPRSLGFPPTMWELEGEGFQQDQEKGAPRTEICLEDSTLTIQGQGE
GARETLKEVVGSEAEGKGAFLGVEGQRTTEGTHEGEAERSHIHRLLASSPKGTIGDVVSW
GKQDGKVPSIPGELWVLQGLGTKEDSTSEKPQEQTGVTSMTRREEQAEMALQDVIKSLRH
GLQKTQEQAQHQEQLLKEQEGELKALQEQLSRCQEERAQLQAELEKKQREAERKDAVYEE
ELGGQRDLVRAMKSRVLELIQEKDILWQKVQHLSSVAPGCCVVCSKIFGRLSRRYPCRLC
GGLVCHACSVDYKKRERHCPPCSQRRDAHVL
Download sequence
Identical sequences W5QDV7
ENSOARP00000020905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]