SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021281 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021281
Domain Number 1 Region: 1014-1105
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-26
Family PDZ domain 0.00027
Further Details:      
 
Domain Number 2 Region: 838-938
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-24
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 396-499
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-23
Family PDZ domain 0.0000551
Further Details:      
 
Domain Number 4 Region: 699-811
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 554-663
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-17
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 6 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 290-327
Classification Level Classification E-value
Superfamily WW domain 0.000000000000371
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 338-372
Classification Level Classification E-value
Superfamily WW domain 0.00000000135
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000223
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021281   Gene: ENSOARG00000019818   Transcript: ENSOART00000021578
Sequence length 1475
Comment pep:known_by_projection chromosome:Oar_v3.1:1:89884749:90130086:1 gene:ENSOARG00000019818 transcript:ENSOART00000021578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGAPGDLGAEIRGGAERGEFPYLGRLREDPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGTLLES
GTYDGNFYGTPKPPAEPSPFQADPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAVNGSGNAAENRERHSEPSDWIKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNW
EMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVD
HLNQKTQFENPVEEAKRKKQLGQADTGSSKPDTEKSHFTRDPSQLKGVLVRASLKKSTMG
FGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGSCVLGHTHADVVQMFQL
VPVSQYVNLTLCRGYPLPDDNEDPVVDIVAATPVINGQSLTKGETCMNTQDFKSGAVVLD
QNGKSGHSLISDRFNGASDLSEQRASMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQ
KVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPS
PTKTAKLKTDKKETSESLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKP
PNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGI
PVKGKSHKQVLDLMTAAARNGHVLLTVRRKIFYGEKQPEDDSSQAFLSAQNGSPRLNRAE
VLARPAPQEPYDVVLQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIEGSPADRCGKLKV
GDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHLGPPSGTNSARQSPALQHR
PMGQSQANHIPGDRSATEGEIGKDVSISYRHSWSDHKHLAQPDTATISVVGGRHSQGLGC
YPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGI
THTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDINNPTSSNVIYDEQSPCHPSSHSASI
FEESHVPVTEESLMKVQICEKAEELKDTVPEKKSTLNENQSDIKHKSLLHKNVNKRDPPN
SHGHGDKKNLLKAGNGITPRGRSASPKKSANPYPEEHAEKIPSPLKNDPKRRPRDRSLSP
RKGENKSSQLGVGTASGQDHCGKSRGRSSSPKKQQKTEGSKDQSNASRRAGGHASDNAEQ
ISDAKERSGVFGRDANQSQPGKNRTRSPEKKSKRVDERSLPSKKTNNITSRAIPENEKGK
KATSGHISSSKDKTGENVRISEKKLKQEPDERMVLSKTEDHKRKELEAADKSKESRGFKP
ESGSPARKTAITPGPWKVPSASRATGAPGVAEKRL
Download sequence
Identical sequences W5QEY3
ENSOARP00000021281 XP_004002386.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]