SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021755 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021755
Domain Number 1 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 69-131
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 459-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000021755
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000687
Family SCAN domain 0.011
Further Details:      
 
Domain Number - Region: 239-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0327
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021755   Gene: ENSOARG00000020260   Transcript: ENSOART00000022059
Sequence length 524
Comment pep:known_by_projection chromosome:Oar_v3.1:1:14827355:14845136:1 gene:ENSOARG00000020260 transcript:ENSOART00000022059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASTWVKLHHPEKAKEGAPLWEVVTKMFEGGALLSQDADETQGESLKDE
LIPRTPTADSQELLTFKDISVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVAGCQLSK
PSVISQLEKGEEPWMTEKEGPGDPSSDLESKTETSASNAKYNILQKQLYHGMMMERLMRD
DVIYSTLKKVSKYDDELEKHQDHHGRNVRQTIMIHKKRSQETYKFGKNIVSSNVVIEQRL
RKCDTPRKRNKCKSDLITHPTSYVRVKTYECNICEKAFKQPIHLTEHMRIHTGEKPFRCK
ECGRAFSQSASLTTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPFICDKCQK
AFSQNISLIQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTFSH
RAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSF
KKHQRHHTGEKPYECNECGKAFSYNSSLTRHHEIHKRNVFQNHI
Download sequence
Identical sequences W5QGA6
ENSOARP00000021755 XP_004001891.1.66739 XP_011960552.1.66739 XP_011960609.1.66739 XP_011960791.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]