SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021902 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021902
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-51
Family C-type lysozyme 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021902   Gene: ENSOARG00000020393   Transcript: ENSOART00000022207
Sequence length 147
Comment pep:novel chromosome:Oar_v3.1:3:150288480:150293529:-1 gene:ENSOARG00000020393 transcript:ENSOART00000022207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALVILGLLCLSVAVQGKVFERCELARTLKELGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENNIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVEGCSL
Download sequence
Identical sequences W5QGQ3
ENSOARP00000021902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]