SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000022656 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000022656
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.51e-46
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 1015-1069
Classification Level Classification E-value
Superfamily HMG-box 0.000000511
Family HMG-box 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000022656   Gene: ENSOARG00000021081   Transcript: ENSOART00000022968
Sequence length 1127
Comment pep:known_by_projection chromosome:Oar_v3.1:7:64376736:64426508:-1 gene:ENSOARG00000021081 transcript:ENSOART00000022968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATQKPMRYGHTEGHTDVCFDDSGSCIVTSGSDGDVRIWEDLDDDDPKSINVGEKAYSC
ALKNGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKI
VDVMDCSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVKVWQISDQTCPVSWPLLQKC
NDVVNAKSICRLAWQPKSGKLLAVPVEKSVKLYRRETWSNQFDLSDDFISQTLNIVTWSP
CGQYLAAGSINGLIIIWNVETKNCIERVKHEKGYAICGLSWHPTCAQIAYTDAEGNLGLL
ENVCDPNGKMSNSKVSSRVEKDYKDLFDGDDTSNVSDCLKDNAVKTHSFSKGIVNDEEDD
DDLMLASGRPRQRSHILEDDENSVDVTMLKIGSSLFKEEEDDQGGSIHNLPVVASQRPFY
DGPMPTPRQKPFQSGSTPVHLTHRFMVWNSVGIIRCYNDEQDNAIDVEFHDTSIHHATHL
LNTFNYTVADLSREAVLLACESTDELASKLHCLHLSSWDSSKEWIVDMPPNEDIEAICLG
QGWAAAATTSLLLRLFTIGGVQKEVFSLPGPVVSMAGHGEQLVIIYHRGTGFDGDQCLGV
QLLELGKKKKQILHGDPLPLTRKSYLVWVGFSAEGTPCYVDSEGIVRMLNRGLGHTWTPV
CNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAVLSFKLPYCQTATE
KGQMEEQYWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLLKMLALSCKLEREFRC
VELAGLMTQNAVNLAIKYASRSRRLILAQRLSELAAEKAAELAATQAEEEEEEDFRKKLN
AGYSNTSTEWSQPRLRNQVEEDTEDNGEADNTEERPEIHKHGESPFFKSADSSDMLALKK
GAVISSSQGRINPFKVSGSSKEPAISVNSGRSTNILDSMNKSSKKSTAFNRATDDEKSPV
IKPLIPKPKSKQASAASFFQKRTSQADRTEEVKEENPKNSSSETPAVCPQNTENQRPKTG
FQMWLEENRSHILSDNPDFSDEADIIKEGMVRFKVLSTEERKAWAAKAKGGTASDGAEEK
KRKRVVDESQETENQEEKMKNLNLPKKQKPLDLSTNQKLSAFAFKQE
Download sequence
Identical sequences W5QIV4
ENSOARP00000022656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]