SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000014502 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000014502
Domain Number 1 Region: 219-281
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000187
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 2 Region: 113-135
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0042
Further Details:      
 
Weak hits

Sequence:  EPrPA00000014502
Domain Number - Region: 157-177
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0053
Further Details:      
 
Domain Number - Region: 308-330
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00628
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000014502
Sequence length 400
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_29:24736:26002:-1 gene:maker-pag1_scaffold_29-snap-gene-0.44 transcript:EPrPAT00000014502 description:"Makorin."
Sequence
MEAHAAADSDASVEYYWSPDEAEYMDEYTDGYAAWDVEAEEEEDDDDEEMDDYLAWDAQA
MENDDHDEESCSDEEYEDSSDEERYLEYANSGRRRNHRPTTPPPAAPLEPPPPTLCRFFV
LGKCRFGSRCTYSHTIPCSGDEGDPDVMATVAATLVDCPFFQRGNCKYGDYCRLRHAQSG
ERDTSNQRTHQVANSRAQDYPRARDPGGATPSNISGSSNQQEEFTCGICFEDIVQAGKYF
GLLSCDHCFCLDCLREWRKAKDMEAEVTRACPACRTPSNYIVPSLRFCTGDAKNEVVDAY
KRHLAIRECKYFDGSFGSCPFGPNCFYAHRNAAGNDVKHLDRPRRSRRRNDSLDSFSSAG
GGRRRRIPDPLSSLLSRYNDFFRFLESFDWDEYDSRSSTH
Download sequence
Identical sequences EPrPA00000014502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]