SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000015289 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000015289
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000111
Family Ubiquitin-related 0.0036
Further Details:      
 
Domain Number 2 Region: 125-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000405
Family Classic zinc finger, C2H2 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000015289
Sequence length 323
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_54:5895:6866:1 gene:snap_masked-pag1_scaffold_54-abinit-gene-0.55 transcript:EPrPAT00000015289 description:"Splicing factor 3A subunit."
Sequence
MELFVRGPSDALHCIRCSAGDCVATLRERVHDATALPLDAIRLRFASLALHDDTARLSDL
PLYSGASIDLFLLIRGGMDFQNRVGSKPGSGGVASESQANADRRERLRKLALETIDISKD
PYFMKNHLGTYECKLCLTLHNNEGNYLAHTQGKRHQTNLARRAAKEAQDAANSTSLASFM
AAQAAAAAAATKPRPLRIGLPGYKVTKQRDPDTGARILLFQIAYPDHDPKLQPRHRFMSP
FEQKIETPDKSVQYLLFACEPYETIAFKIPNMEVDKSEGKFFSNWDKDGKTFTLQLTFVA
DENDGNGTHKPAPPPPRPQLRYP
Download sequence
Identical sequences EPrPA00000015289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]