SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000018635 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000018635
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.03e-62
Family Tubulin, GTPase domain 0.0000073
Further Details:      
 
Domain Number 2 Region: 337-513
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 7.32e-56
Family Tubulin, C-terminal domain 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000018635
Sequence length 532
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_212:6504:8282:1 gene:maker-pag1_scaffold_212-snap-gene-0.12 transcript:EPrPAT00000018635 description:"Tubulin/FtsZ family protein."
Sequence
MPRELITIQVGQCGNQIGRQFWQLALEEHAKVTTKFTRARSTSESNSQHARFDESMSTFF
HNIDTRTTSHTAATPDKYSTIKALKARAILVDMEEGPVAETLAGPLGDLFDQQQFITDVS
GAGNNWAHGHCLYGPKYKDVLREKLHRATELCDSLQSFFVLHSLGGGTGSGLGTYILGLL
EDEYPEVYRFTTAIFPSEDDDVVTSPYNSVLSLNQLTHHADCVLPIENEALTEICSSTTE
KLERGGGSIFLSSPATSSIPQIGPVTDLGLLEKFYKKGIPLSDSAHASKSKPLMGKERHR
PAQPQHRGRSAFGDMNHIVARLLTDLTSSMRFEGSLNVDLNEITTNLVPFPKLHFLLSSI
SPIRTTRDPRQQPRRVSQVFSDVFSRDNQLIRSNPRSNTYLACGLLVRGNVEISDINTNI
QRLQSEVRMIAWNQDGFKVGLCRVPPVGQSSSVLCLSNNTCIGETFQRMRDRFRKLYARR
AHVHHYAEYMDSDQLTEAFENVTHLINEYNKLEATHTRSEEKISRTRLRPLE
Download sequence
Identical sequences EPrPA00000018635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]