SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000024220 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000024220
Domain Number 1 Region: 315-449
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-25
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 11-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000114
Family DIX domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000024220
Sequence length 453
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_950:5493:6854:1 gene:maker-pag1_scaffold_950-fgenesh-gene-0.0 transcript:EPrPAT00000024220 description:"Tyrosine-protein phosphatase auxilin."
Sequence
MASAGGVWAFYYIQGEEGEDRSHPNAFKIPGGSSDVTLADVHRHFPLKDPGAFHFRFRIN
TSVKTANGATSTFFWLDITSPSQKVPLVNGRVICKLLRLARPHKTGLIFKRKPVLKWSNE
AVPPKPTVSRQPSGSAYEKERPAKYSDTPPSGTPPPERTASSSSVNGRTSSGSASGSAPS
SRTGSGSSRKAEVPPQPAESFEDFLSGGQPAQAPKADVNLMSDSGWSDSQPAPKSSANDF
LNSMDPLAQPTGGASGGTARSATTQSTEQPKFEDDGGQTVGPVTMAEMQKFAVSSDGTNV
YNPKFVDKSTKSEHVRRAMEERERQIQADVEKAREELRQREAAKNQMNAMKESASAVLGP
KLKAWAEDNGRVKNIRTLLSTMHQVMWEDSKWGEVNMAKLIQPNDIKRQYRKAMIVVHPD
KSSGRNAEQLLIAERVFAALNTAWDEFMKTNPC
Download sequence
Identical sequences EPrPA00000024220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]