SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPA00000024623 from Pythium aphanidermatum DAOM BR444 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPA00000024623
Domain Number 1 Region: 141-407,453-529
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.04e-57
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00039
Further Details:      
 
Domain Number 2 Region: 23-115
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-21
Family Zf-UBP 0.0058
Further Details:      
 
Domain Number 3 Region: 413-450
Classification Level Classification E-value
Superfamily SAP domain 0.00000558
Family SAP domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPA00000024623
Sequence length 531
Comment pep:novel supercontig:GCA_000387445.2:pag1_scaffold_1102:83:1953:-1 gene:maker-pag1_scaffold_1102-snap-gene-0.4 transcript:EPrPAT00000024623 description:"U4/U6.U5 tri-snRNP-associated protein."
Sequence
MGGMKRPADDELEAEGIGAKRRKCPYLDTINHQLLDFDFEKVCSISLSDQNVYACLVCGK
FFQGRGKSTHAYTHSVQNGHHVFINLQNDRIYCLPDNYEVVDTALQPIKNALRPTFHLDA
VAKLDANRLLAQDAFGVSYLPGFIGLNNLKHTDYINVVVQALAHVPPLRDYFLLTSNTVG
KTKSNLVLRFGELVRKMWSPHNFKNTISPHEFVQEVSVSSKKRFHVGQQNESVEFLSWLL
NELHRGLGGSHKPGSSVIHKCFQGLVEVQTTDDTKPAITVDEDDEEEKKSEDAPASTPSV
AKTTKTPFLLLSLDLPSTPLFKDCQCGNIIPQIPLFTVLEKYDGKHVTHVLQGSQRLQKT
YSIKSLPSYLIFHVKRFTRNNFFVEKNPTIVNFPIKNLELRDYVQFDTEVHSEEELKAMS
ITQLRELLIKHKTSWKDCVEKADLVDKAVRVVLPATKYNLIANVCHDSPVTTGKETAALK
ANPLTEGSYRVHLQNRATEQWYEIQDLHVQETMPQLIGVSESYLMIYERKQ
Download sequence
Identical sequences EPrPA00000024623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]