SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|528818911|ref|YP_008360114.1| from Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528818911|ref|YP_008360114.1|
Domain Number 1 Region: 49-162,197-373
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-29
Family Kelch motif 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|528818911|ref|YP_008360114.1|
Sequence length 386
Comment N-acetylneuraminate epimerase [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
Sequence
MGMQMKNFKKMMTLMALCLSVAITTSGYATTLPDIPEPLKNGTGAIDNNGVIYVGLGTAG
TSWYKIDLKKQHKDWERIKSFPGGAREQSVSVFLNDELYVFGGVGKKNSESPLQVYSDVY
KYSPVKNTWQKVDTISPVGLTGHTGVKLNETMVLITGGVNEHIFDKYFIDIAAAAADESE
KNKVIYNYFNKPAKDYFFNKIVFIYNAKENTWKNAGELPDAGTAGSSSVMENNFLMLING
ELKPGLRTDVIYRAMWDNDKLTWLKNSQLPPSPGEQQQEGLAGAFSGYSHGVLLVGGGAN
FPGAKQNYTNGKFYSHEGINKKWRDEVYGLVNGHWQYMGKMKQPLGYGVSVSYGDEVFLI
GGENAKGKPVSSVTSFTMRDGNLLIK
Download sequence
Identical sequences A0A0R9MRC7 A0A1S1AF70 A0A2D3TY23 A9N6P2 B4T2W1 G5NBC9 G5SDE5 Q57QM5 V1XNI7
ABEW01000012|CDS_84428-85588 ABFH02000002|CDS_927899-926739 AE017220|CDS_1198759-1199919 CP001113|CDS_1221800-1222960 gi|549479008|ref|YP_008612917.1| 321314.SC1080 423368.SNSL254_A1225 gi|62179650|ref|YP_216067.1| gi|525947662|ref|YP_008309097.1| WP_000525756.1.100115 WP_000525756.1.100266 WP_000525756.1.100432 WP_000525756.1.100472 WP_000525756.1.100502 WP_000525756.1.100521 WP_000525756.1.100650 WP_000525756.1.100711 WP_000525756.1.100870 WP_000525756.1.101042 WP_000525756.1.101091 WP_000525756.1.101123 WP_000525756.1.101126 WP_000525756.1.101185 WP_000525756.1.101454 WP_000525756.1.101520 WP_000525756.1.101612 WP_000525756.1.101636 WP_000525756.1.101724 WP_000525756.1.101841 WP_000525756.1.10191 WP_000525756.1.101975 WP_000525756.1.10237 WP_000525756.1.10465 WP_000525756.1.10521 WP_000525756.1.10568 WP_000525756.1.10675 WP_000525756.1.10711 WP_000525756.1.10720 WP_000525756.1.11362 WP_000525756.1.11565 WP_000525756.1.11868 WP_000525756.1.11964 WP_000525756.1.12244 WP_000525756.1.12456 WP_000525756.1.12584 WP_000525756.1.12701 WP_000525756.1.12718 WP_000525756.1.13101 WP_000525756.1.1326 WP_000525756.1.13446 WP_000525756.1.14050 WP_000525756.1.14056 WP_000525756.1.14212 WP_000525756.1.1440 WP_000525756.1.14505 WP_000525756.1.14516 WP_000525756.1.14876 WP_000525756.1.15079 WP_000525756.1.15468 WP_000525756.1.15483 WP_000525756.1.15625 WP_000525756.1.15708 WP_000525756.1.158 WP_000525756.1.15835 WP_000525756.1.15909 WP_000525756.1.16006 WP_000525756.1.1601 WP_000525756.1.16028 WP_000525756.1.16244 WP_000525756.1.16331 WP_000525756.1.16551 WP_000525756.1.16819 WP_000525756.1.1689 WP_000525756.1.16941 WP_000525756.1.16944 WP_000525756.1.17098 WP_000525756.1.17285 WP_000525756.1.1737 WP_000525756.1.17390 WP_000525756.1.17439 WP_000525756.1.17447 WP_000525756.1.17560 WP_000525756.1.1757 WP_000525756.1.17755 WP_000525756.1.17758 WP_000525756.1.17865 WP_000525756.1.17901 WP_000525756.1.17991 WP_000525756.1.18022 WP_000525756.1.18089 WP_000525756.1.18178 WP_000525756.1.1825 WP_000525756.1.18281 WP_000525756.1.18692 WP_000525756.1.1897 WP_000525756.1.1968 WP_000525756.1.19723 WP_000525756.1.19740 WP_000525756.1.19851 WP_000525756.1.1990 WP_000525756.1.19967 WP_000525756.1.20089 WP_000525756.1.20376 WP_000525756.1.20391 WP_000525756.1.20415 WP_000525756.1.20425 WP_000525756.1.20488 WP_000525756.1.20631 WP_000525756.1.20695 WP_000525756.1.20721 WP_000525756.1.20862 WP_000525756.1.20900 WP_000525756.1.21309 WP_000525756.1.21326 WP_000525756.1.21404 WP_000525756.1.2146 WP_000525756.1.21792 WP_000525756.1.21845 WP_000525756.1.22117 WP_000525756.1.22169 WP_000525756.1.2224 WP_000525756.1.22270 WP_000525756.1.22337 WP_000525756.1.22514 WP_000525756.1.22575 WP_000525756.1.22582 WP_000525756.1.22845 WP_000525756.1.23148 WP_000525756.1.23169 WP_000525756.1.23246 WP_000525756.1.2342 WP_000525756.1.23466 WP_000525756.1.23503 WP_000525756.1.23621 WP_000525756.1.23646 WP_000525756.1.23685 WP_000525756.1.23736 WP_000525756.1.23755 WP_000525756.1.2376 WP_000525756.1.24259 WP_000525756.1.24325 WP_000525756.1.24392 WP_000525756.1.2467 WP_000525756.1.24995 WP_000525756.1.25498 WP_000525756.1.25564 WP_000525756.1.25700 WP_000525756.1.25928 WP_000525756.1.26030 WP_000525756.1.26123 WP_000525756.1.26269 WP_000525756.1.2634 WP_000525756.1.26363 WP_000525756.1.26426 WP_000525756.1.26576 WP_000525756.1.26582 WP_000525756.1.2660 WP_000525756.1.26882 WP_000525756.1.26924 WP_000525756.1.27072 WP_000525756.1.27279 WP_000525756.1.27342 WP_000525756.1.27513 WP_000525756.1.27522 WP_000525756.1.27616 WP_000525756.1.27679 WP_000525756.1.27713 WP_000525756.1.27755 WP_000525756.1.27815 WP_000525756.1.27997 WP_000525756.1.28235 WP_000525756.1.2825 WP_000525756.1.28612 WP_000525756.1.28948 WP_000525756.1.29099 WP_000525756.1.29130 WP_000525756.1.29255 WP_000525756.1.29349 WP_000525756.1.29454 WP_000525756.1.29530 WP_000525756.1.29682 WP_000525756.1.29768 WP_000525756.1.29774 WP_000525756.1.29775 WP_000525756.1.2984 WP_000525756.1.29845 WP_000525756.1.29923 WP_000525756.1.29924 WP_000525756.1.30179 WP_000525756.1.30195 WP_000525756.1.30238 WP_000525756.1.30246 WP_000525756.1.30356 WP_000525756.1.30573 WP_000525756.1.3068 WP_000525756.1.3076 WP_000525756.1.30909 WP_000525756.1.31107 WP_000525756.1.3114 WP_000525756.1.31210 WP_000525756.1.31222 WP_000525756.1.31476 WP_000525756.1.31665 WP_000525756.1.31762 WP_000525756.1.31854 WP_000525756.1.31952 WP_000525756.1.32423 WP_000525756.1.32434 WP_000525756.1.32493 WP_000525756.1.32747 WP_000525756.1.32902 WP_000525756.1.32961 WP_000525756.1.33078 WP_000525756.1.33106 WP_000525756.1.33499 WP_000525756.1.33609 WP_000525756.1.33629 WP_000525756.1.33986 WP_000525756.1.34126 WP_000525756.1.34259 WP_000525756.1.3445 WP_000525756.1.34458 WP_000525756.1.34496 WP_000525756.1.34667 WP_000525756.1.3476 WP_000525756.1.34854 WP_000525756.1.3489 WP_000525756.1.34972 WP_000525756.1.35460 WP_000525756.1.3556 WP_000525756.1.3566 WP_000525756.1.35777 WP_000525756.1.36011 WP_000525756.1.36157 WP_000525756.1.36542 WP_000525756.1.36899 WP_000525756.1.36948 WP_000525756.1.36949 WP_000525756.1.36978 WP_000525756.1.37320 WP_000525756.1.37351 WP_000525756.1.37478 WP_000525756.1.37521 WP_000525756.1.37558 WP_000525756.1.3756 WP_000525756.1.38001 WP_000525756.1.38199 WP_000525756.1.38273 WP_000525756.1.38740 WP_000525756.1.38881 WP_000525756.1.38895 WP_000525756.1.39038 WP_000525756.1.39497 WP_000525756.1.39553 WP_000525756.1.39576 WP_000525756.1.39609 WP_000525756.1.39723 WP_000525756.1.40111 WP_000525756.1.40229 WP_000525756.1.40254 WP_000525756.1.40258 WP_000525756.1.40259 WP_000525756.1.40374 WP_000525756.1.40648 WP_000525756.1.41438 WP_000525756.1.41735 WP_000525756.1.4178 WP_000525756.1.41789 WP_000525756.1.41877 WP_000525756.1.42009 WP_000525756.1.42238 WP_000525756.1.4239 WP_000525756.1.42605 WP_000525756.1.42685 WP_000525756.1.42767 WP_000525756.1.42797 WP_000525756.1.42829 WP_000525756.1.42887 WP_000525756.1.42957 WP_000525756.1.43086 WP_000525756.1.43160 WP_000525756.1.43276 WP_000525756.1.43441 WP_000525756.1.43476 WP_000525756.1.43528 WP_000525756.1.4373 WP_000525756.1.43875 WP_000525756.1.4405 WP_000525756.1.44438 WP_000525756.1.44440 WP_000525756.1.44443 WP_000525756.1.44593 WP_000525756.1.44633 WP_000525756.1.44678 WP_000525756.1.44702 WP_000525756.1.44781 WP_000525756.1.44833 WP_000525756.1.449 WP_000525756.1.44943 WP_000525756.1.44950 WP_000525756.1.45027 WP_000525756.1.4540 WP_000525756.1.45781 WP_000525756.1.46028 WP_000525756.1.46091 WP_000525756.1.46205 WP_000525756.1.46250 WP_000525756.1.46286 WP_000525756.1.46322 WP_000525756.1.46345 WP_000525756.1.46444 WP_000525756.1.46572 WP_000525756.1.46574 WP_000525756.1.46666 WP_000525756.1.46689 WP_000525756.1.4671 WP_000525756.1.46730 WP_000525756.1.46803 WP_000525756.1.46961 WP_000525756.1.47257 WP_000525756.1.47389 WP_000525756.1.47482 WP_000525756.1.47587 WP_000525756.1.4770 WP_000525756.1.47714 WP_000525756.1.4775 WP_000525756.1.47814 WP_000525756.1.47817 WP_000525756.1.47902 WP_000525756.1.47928 WP_000525756.1.47992 WP_000525756.1.48132 WP_000525756.1.48209 WP_000525756.1.48455 WP_000525756.1.48755 WP_000525756.1.48855 WP_000525756.1.48886 WP_000525756.1.48985 WP_000525756.1.49012 WP_000525756.1.49102 WP_000525756.1.49175 WP_000525756.1.49226 WP_000525756.1.49276 WP_000525756.1.49304 WP_000525756.1.49472 WP_000525756.1.49590 WP_000525756.1.49931 WP_000525756.1.50003 WP_000525756.1.50007 WP_000525756.1.5009 WP_000525756.1.50239 WP_000525756.1.50251 WP_000525756.1.50469 WP_000525756.1.50497 WP_000525756.1.50517 WP_000525756.1.50563 WP_000525756.1.50576 WP_000525756.1.5058 WP_000525756.1.50777 WP_000525756.1.50800 WP_000525756.1.51131 WP_000525756.1.51162 WP_000525756.1.51285 WP_000525756.1.51308 WP_000525756.1.51414 WP_000525756.1.51514 WP_000525756.1.51555 WP_000525756.1.51611 WP_000525756.1.52047 WP_000525756.1.52156 WP_000525756.1.5216 WP_000525756.1.52255 WP_000525756.1.52356 WP_000525756.1.52438 WP_000525756.1.52528 WP_000525756.1.52744 WP_000525756.1.53454 WP_000525756.1.53534 WP_000525756.1.53675 WP_000525756.1.53694 WP_000525756.1.53696 WP_000525756.1.53772 WP_000525756.1.53935 WP_000525756.1.54061 WP_000525756.1.54082 WP_000525756.1.54333 WP_000525756.1.5456 WP_000525756.1.54569 WP_000525756.1.54774 WP_000525756.1.54814 WP_000525756.1.5485 WP_000525756.1.5493 WP_000525756.1.54992 WP_000525756.1.55073 WP_000525756.1.5517 WP_000525756.1.55178 WP_000525756.1.55223 WP_000525756.1.5527 WP_000525756.1.55294 WP_000525756.1.55545 WP_000525756.1.55557 WP_000525756.1.55706 WP_000525756.1.56026 WP_000525756.1.56059 WP_000525756.1.56100 WP_000525756.1.56247 WP_000525756.1.56305 WP_000525756.1.56389 WP_000525756.1.56393 WP_000525756.1.56512 WP_000525756.1.56647 WP_000525756.1.56893 WP_000525756.1.56905 WP_000525756.1.57000 WP_000525756.1.57125 WP_000525756.1.57149 WP_000525756.1.57233 WP_000525756.1.57307 WP_000525756.1.57357 WP_000525756.1.57510 WP_000525756.1.57735 WP_000525756.1.57781 WP_000525756.1.57797 WP_000525756.1.57902 WP_000525756.1.58040 WP_000525756.1.58144 WP_000525756.1.58157 WP_000525756.1.58249 WP_000525756.1.58301 WP_000525756.1.58564 WP_000525756.1.58604 WP_000525756.1.58831 WP_000525756.1.58861 WP_000525756.1.59097 WP_000525756.1.59125 WP_000525756.1.59236 WP_000525756.1.59294 WP_000525756.1.59381 WP_000525756.1.59439 WP_000525756.1.59512 WP_000525756.1.59641 WP_000525756.1.59928 WP_000525756.1.60015 WP_000525756.1.60052 WP_000525756.1.60209 WP_000525756.1.60486 WP_000525756.1.6052 WP_000525756.1.60597 WP_000525756.1.60608 WP_000525756.1.60643 WP_000525756.1.60746 WP_000525756.1.60838 WP_000525756.1.60919 WP_000525756.1.6108 WP_000525756.1.61146 WP_000525756.1.61201 WP_000525756.1.61218 WP_000525756.1.61233 WP_000525756.1.61509 WP_000525756.1.6164 WP_000525756.1.62076 WP_000525756.1.6210 WP_000525756.1.62222 WP_000525756.1.62271 WP_000525756.1.62339 WP_000525756.1.62344 WP_000525756.1.62564 WP_000525756.1.63043 WP_000525756.1.63129 WP_000525756.1.63186 WP_000525756.1.63234 WP_000525756.1.63250 WP_000525756.1.63422 WP_000525756.1.63568 WP_000525756.1.63677 WP_000525756.1.63766 WP_000525756.1.63824 WP_000525756.1.63831 WP_000525756.1.63934 WP_000525756.1.6399 WP_000525756.1.63992 WP_000525756.1.64007 WP_000525756.1.64242 WP_000525756.1.6437 WP_000525756.1.64569 WP_000525756.1.64667 WP_000525756.1.64690 WP_000525756.1.64919 WP_000525756.1.64920 WP_000525756.1.64977 WP_000525756.1.65016 WP_000525756.1.65022 WP_000525756.1.65027 WP_000525756.1.65052 WP_000525756.1.65163 WP_000525756.1.65185 WP_000525756.1.65394 WP_000525756.1.65558 WP_000525756.1.6560 WP_000525756.1.6572 WP_000525756.1.65795 WP_000525756.1.65838 WP_000525756.1.65876 WP_000525756.1.6594 WP_000525756.1.66167 WP_000525756.1.66235 WP_000525756.1.66270 WP_000525756.1.66272 WP_000525756.1.66462 WP_000525756.1.66534 WP_000525756.1.66630 WP_000525756.1.66807 WP_000525756.1.66876 WP_000525756.1.67 WP_000525756.1.67184 WP_000525756.1.67374 WP_000525756.1.67803 WP_000525756.1.67827 WP_000525756.1.67905 WP_000525756.1.67924 WP_000525756.1.67942 WP_000525756.1.67977 WP_000525756.1.6809 WP_000525756.1.68210 WP_000525756.1.6833 WP_000525756.1.68478 WP_000525756.1.68532 WP_000525756.1.6869 WP_000525756.1.68690 WP_000525756.1.6875 WP_000525756.1.68818 WP_000525756.1.68958 WP_000525756.1.69011 WP_000525756.1.69288 WP_000525756.1.69346 WP_000525756.1.69371 WP_000525756.1.69465 WP_000525756.1.69515 WP_000525756.1.69754 WP_000525756.1.69785 WP_000525756.1.69808 WP_000525756.1.69848 WP_000525756.1.69975 WP_000525756.1.7014 WP_000525756.1.7016 WP_000525756.1.70248 WP_000525756.1.70321 WP_000525756.1.70326 WP_000525756.1.70488 WP_000525756.1.70523 WP_000525756.1.70547 WP_000525756.1.70580 WP_000525756.1.70914 WP_000525756.1.70969 WP_000525756.1.71010 WP_000525756.1.7110 WP_000525756.1.71248 WP_000525756.1.71418 WP_000525756.1.71446 WP_000525756.1.7174 WP_000525756.1.72065 WP_000525756.1.72068 WP_000525756.1.72107 WP_000525756.1.72226 WP_000525756.1.72351 WP_000525756.1.72382 WP_000525756.1.72412 WP_000525756.1.72642 WP_000525756.1.72689 WP_000525756.1.72827 WP_000525756.1.72850 WP_000525756.1.72887 WP_000525756.1.72892 WP_000525756.1.73144 WP_000525756.1.73362 WP_000525756.1.73379 WP_000525756.1.73535 WP_000525756.1.73701 WP_000525756.1.7386 WP_000525756.1.74117 WP_000525756.1.74418 WP_000525756.1.74620 WP_000525756.1.74639 WP_000525756.1.74644 WP_000525756.1.74661 WP_000525756.1.74702 WP_000525756.1.74826 WP_000525756.1.74992 WP_000525756.1.74996 WP_000525756.1.75009 WP_000525756.1.75058 WP_000525756.1.75180 WP_000525756.1.75402 WP_000525756.1.75609 WP_000525756.1.75703 WP_000525756.1.75793 WP_000525756.1.75873 WP_000525756.1.76097 WP_000525756.1.76162 WP_000525756.1.76208 WP_000525756.1.76301 WP_000525756.1.76364 WP_000525756.1.76471 WP_000525756.1.76548 WP_000525756.1.76576 WP_000525756.1.76738 WP_000525756.1.76806 WP_000525756.1.77271 WP_000525756.1.77390 WP_000525756.1.77414 WP_000525756.1.77436 WP_000525756.1.77543 WP_000525756.1.77575 WP_000525756.1.77653 WP_000525756.1.77754 WP_000525756.1.77846 WP_000525756.1.78053 WP_000525756.1.78201 WP_000525756.1.78245 WP_000525756.1.78301 WP_000525756.1.78495 WP_000525756.1.78496 WP_000525756.1.78602 WP_000525756.1.78738 WP_000525756.1.79032 WP_000525756.1.79235 WP_000525756.1.79297 WP_000525756.1.79302 WP_000525756.1.79645 WP_000525756.1.7979 WP_000525756.1.79892 WP_000525756.1.79914 WP_000525756.1.79966 WP_000525756.1.80236 WP_000525756.1.80250 WP_000525756.1.80293 WP_000525756.1.80479 WP_000525756.1.80529 WP_000525756.1.80586 WP_000525756.1.80629 WP_000525756.1.80651 WP_000525756.1.80667 WP_000525756.1.80674 WP_000525756.1.80750 WP_000525756.1.80857 WP_000525756.1.80959 WP_000525756.1.80973 WP_000525756.1.81275 WP_000525756.1.81302 WP_000525756.1.81321 WP_000525756.1.81472 WP_000525756.1.81504 WP_000525756.1.81667 WP_000525756.1.81965 WP_000525756.1.81977 WP_000525756.1.81995 WP_000525756.1.82269 WP_000525756.1.82395 WP_000525756.1.82529 WP_000525756.1.82584 WP_000525756.1.82648 WP_000525756.1.82841 WP_000525756.1.82843 WP_000525756.1.82895 WP_000525756.1.82937 WP_000525756.1.82946 WP_000525756.1.82992 WP_000525756.1.83061 WP_000525756.1.83119 WP_000525756.1.83301 WP_000525756.1.83382 WP_000525756.1.83510 WP_000525756.1.83516 WP_000525756.1.83650 WP_000525756.1.83759 WP_000525756.1.83854 WP_000525756.1.83897 WP_000525756.1.83960 WP_000525756.1.83979 WP_000525756.1.84168 WP_000525756.1.84355 WP_000525756.1.84683 WP_000525756.1.849 WP_000525756.1.85014 WP_000525756.1.85120 WP_000525756.1.85147 WP_000525756.1.85469 WP_000525756.1.8552 WP_000525756.1.85675 WP_000525756.1.85723 WP_000525756.1.85742 WP_000525756.1.86017 WP_000525756.1.86310 WP_000525756.1.86335 WP_000525756.1.86389 WP_000525756.1.86601 WP_000525756.1.86634 WP_000525756.1.86807 WP_000525756.1.86860 WP_000525756.1.86982 WP_000525756.1.87143 WP_000525756.1.87283 WP_000525756.1.87626 WP_000525756.1.87875 WP_000525756.1.88014 WP_000525756.1.88174 WP_000525756.1.88222 WP_000525756.1.88303 WP_000525756.1.88651 WP_000525756.1.88698 WP_000525756.1.88762 WP_000525756.1.88942 WP_000525756.1.88995 WP_000525756.1.89054 WP_000525756.1.89188 WP_000525756.1.89452 WP_000525756.1.89632 WP_000525756.1.89965 WP_000525756.1.9002 WP_000525756.1.90033 WP_000525756.1.90084 WP_000525756.1.90193 WP_000525756.1.90311 WP_000525756.1.90348 WP_000525756.1.90363 WP_000525756.1.90566 WP_000525756.1.90866 WP_000525756.1.90984 WP_000525756.1.91049 WP_000525756.1.91405 WP_000525756.1.91459 WP_000525756.1.91470 WP_000525756.1.91580 WP_000525756.1.91625 WP_000525756.1.91903 WP_000525756.1.92047 WP_000525756.1.92213 WP_000525756.1.92299 WP_000525756.1.92375 WP_000525756.1.92411 WP_000525756.1.92529 WP_000525756.1.92575 WP_000525756.1.92729 WP_000525756.1.92879 WP_000525756.1.92926 WP_000525756.1.92947 WP_000525756.1.92975 WP_000525756.1.92988 WP_000525756.1.93213 WP_000525756.1.93596 WP_000525756.1.93691 WP_000525756.1.93761 WP_000525756.1.93956 WP_000525756.1.93986 WP_000525756.1.94039 WP_000525756.1.94352 WP_000525756.1.94785 WP_000525756.1.94947 WP_000525756.1.94987 WP_000525756.1.95152 WP_000525756.1.9516 WP_000525756.1.95289 WP_000525756.1.95320 WP_000525756.1.95404 WP_000525756.1.95579 WP_000525756.1.9574 WP_000525756.1.95826 WP_000525756.1.95840 WP_000525756.1.96335 WP_000525756.1.96590 WP_000525756.1.96600 WP_000525756.1.96798 WP_000525756.1.96890 WP_000525756.1.96917 WP_000525756.1.97043 WP_000525756.1.97089 WP_000525756.1.97109 WP_000525756.1.97224 WP_000525756.1.97386 WP_000525756.1.97413 WP_000525756.1.97480 WP_000525756.1.97626 WP_000525756.1.97691 WP_000525756.1.97725 WP_000525756.1.97873 WP_000525756.1.9805 WP_000525756.1.98107 WP_000525756.1.98314 WP_000525756.1.98513 WP_000525756.1.98551 WP_000525756.1.98627 WP_000525756.1.98634 WP_000525756.1.98779 WP_000525756.1.98899 WP_000525756.1.98947 WP_000525756.1.99040 WP_000525756.1.99197 WP_000525756.1.99339 WP_000525756.1.99426 gi|194445375|ref|YP_002040383.1| gi|528818911|ref|YP_008360114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]