SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161485768|ref|NP_681487.2| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161485768|ref|NP_681487.2|
Domain Number 1 Region: 39-286
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4e-82
Family Tryptophan biosynthesis enzymes 0.00000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161485768|ref|NP_681487.2|
Sequence length 307
Comment indole-3-glycerol phosphate synthase [Thermosynechococcus elongatus BP-1]
Sequence
MQIRRRPPNPAVTVRNLHYQVPVADDAPRNILEKIVWHKEQEVEQLREVLPLADLQRQVL
EAPPVRSFLAAVQNPVTQPALIAEVKKASPSKGIIRPNFDPVAIAQAYVAAGATCLSVLT
DSEFFQGSFEYLAQIRQEVAVPLLCKDFILYPYQMFLARVRGADAVLLIAAILSDKDLRY
FLRIAHGLGLTALVEVHTAEEMERVLALEDVQLVGINNRNLMDFSVDLATTEKLLANYGA
QLRDRNILVVSESGIHQRADVERMAQAGAQAILVGESLMRPPAAMAHFSEAEELRARIQQ
LFPELAH
Download sequence
Identical sequences 197221.tll0698 gi|161485768|ref|NP_681487.2| NP_681487.2.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]