SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297557|ref|NP_680804.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297557|ref|NP_680804.1|
Domain Number 1 Region: 5-199,300-389
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.57e-83
Family Bacterial dinuclear zinc exopeptidases 0.0000203
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.7e-30
Family Bacterial exopeptidase dimerisation domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22297557|ref|NP_680804.1|
Sequence length 393
Comment N-acetyl-L-amino acid amidohydrolase [Thermosynechococcus elongatus BP-1]
Sequence
MLARIRQITHTLTPRLIEIRRHLHRYPELSGQEHQTAAYVAGVLSSAGLSVQQDVGKVGV
IAELEGNSKEQRLLAIRTDMDALPIQERTGLEFSSKHAGVMHACGHDVHTTVGLGTAMVL
AALKEEFPGRVRFIFQPAEEIAQGASWMIADGAMEAVSAILSLHVFPSIPAGDVAVRYGA
LTAAADDIELTILGESGHGARPHEAVDAIWIAAQVISALQQAISRTQNPLRPVVLTFGKI
QGGRAANVIADQVTLQGTVRSLHPETRATLPTWIEQIVANVCHAYGARYQLHYRRGVPGV
ENTPYLSQLLAEAATEVVGAPHVHILPEPSLGAEDFALYLEHAPGAMFRLGVGFRDRPNY
PLHHPEFDVDEQAIPVGVMTLAHAACRYWQIPY
Download sequence
Identical sequences Q8DMU8
197221.tll0013 gi|22297557|ref|NP_680804.1| NP_680804.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]