SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297579|ref|NP_680826.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22297579|ref|NP_680826.1|
Domain Number - Region: 7-52
Classification Level Classification E-value
Superfamily MetI-like 0.00801
Family MetI-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22297579|ref|NP_680826.1|
Sequence length 110
Comment hypothetical protein tlr0035 [Thermosynechococcus elongatus BP-1]
Sequence
MSLQRTASAIAPRRYGFMTRLLLMSMVLTAIFSPLVTLATPLSPIFNPISPTTGFESSEM
NRLWQNQWPPKDRRKTNTTLQPSSDKVLQIELDGQLLTPSQAQQLLLRQE
Download sequence
Identical sequences Q8DMS6
NP_680826.1.97157 gi|22297579|ref|NP_680826.1| 197221.tlr0035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]