SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297659|ref|NP_680906.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297659|ref|NP_680906.1|
Domain Number 1 Region: 17-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.84e-99
Family Cystathionine synthase-like 0.0000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22297659|ref|NP_680906.1|
Sequence length 397
Comment cysteine desulfurase [Thermosynechococcus elongatus BP-1]
Sequence
MRGDCLRGFLGRLGMRPIYLDGLATTPVDPQVLAAMLPYFSDRPGNPSNRGHAYGWEAAA
AIDVARETIAAAIHAHPEEIIFTSGATEANNLAIKGVAEAYHSRGRHIITVQTEHNAVLA
PCRYLESLGFRVTYLGVNEKGFIDLAELEQAFTPETLLVSVMAANNEIGVLQPLAEIGRR
CRDRGVLFHTDAAQALGKIPLDVQALQVDLMSLTAHKLYGPKGIGALYVRRDRPRVQLAP
QLHGGPQEQGWRSGTLATPLIVGFGAAVQLAQERQATDIPYLWHLKERLWQGLVSLGDIY
LNGDWQQSLPNCLNVSIAGVDGNVLLRSIYPYVALSTGAACSSEKPTPSHVLLALGRSPT
LARASLRFGLLRTTTEADIDTALEQIGRSIWQLRHSK
Download sequence
Identical sequences Q8DMK1
gi|22297659|ref|NP_680906.1| 197221.tlr0115 NP_680906.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]