SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297917|ref|NP_681164.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297917|ref|NP_681164.1|
Domain Number 1 Region: 5-317,427-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.24e-52
Family FAD-linked reductases, N-terminal domain 0.0000326
Further Details:      
 
Domain Number 2 Region: 301-410
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.22e-26
Family L-aminoacid/polyamine oxidase 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297917|ref|NP_681164.1|
Sequence length 467
Comment protoporphyrinogen oxidase [Thermosynechococcus elongatus BP-1]
Sequence
MIEVDVAIVGGGLSGLSVAWRLQRSAPHYSGVLLEASDRLGGNITTQAAEGFVWELGPNS
FAPTPALLQLIAEVGLHSELIRGDRHLPRYIYWRGELYPLEPTRPLALATSNLLSPWGKV
RAALGALGFVPPYLGSGDESVDSFFRRHLGQEVAERLVAPFVSGVYAGDPQQLSAAAAFR
RIAQLEKLGGSLIAGALRLRRQQPPQPKPPAQVQMRPGELGSFREGLAALPRAIAQQLKA
PLHLQTPVEAITPEPKGGYLLRSGEQTWHARSVVLATPAYQTAELVAPFQPAIARALATI
PYPTVACVVLAYPAGLGRSVRPGFGVLVPRGQGIRTLGTIWSSCLFPQRTPAGWQVFTSF
IGGATDPDLASLREEAIVEQVQQDLTRLLDLPAAKARLLGMKVWRRAIPQYIVGYPQQWQ
QVTHALTQTPGLFLCSNYAEGVALGDRVEHGNRTAAAVAAYLAGGQS
Download sequence
Identical sequences Q8DLV2
197221.tlr0374 NP_681164.1.97157 gi|22297917|ref|NP_681164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]