SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297938|ref|NP_681185.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297938|ref|NP_681185.1|
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.83e-60
Family Decarboxylase 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22297938|ref|NP_681185.1|
Sequence length 221
Comment orotidine 5' monophosphate decarboxylase [Thermosynechococcus elongatus BP-1]
Sequence
MALDVPNLEVAIATIHRLPQVQFWKVGLELFCASGPMILDVLKDQGKRIFLDLKLHDIPN
TVAAAARAIAPYGVDFVTIHTATGLTGLKTAQAALGESATQLIGVTLLTSIGADTLQQEL
QIPLDPATYVECMANLAHQAGLAGIVCSPQEAARVKQRWGENFLRICPGIRPLGSATGDQ
ARSLTPNAAFAAGASYLVIGRPILQAADPAAAFDDLCSSLV
Download sequence
Identical sequences 197221.tll0395 NP_681185.1.97157 gi|22297938|ref|NP_681185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]