SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297974|ref|NP_681221.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297974|ref|NP_681221.1|
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 5.49e-21
Family F1F0 ATP synthase subunit C 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297974|ref|NP_681221.1|
Sequence length 99
Comment ATP synthase F0F1 subunit C [Thermosynechococcus elongatus BP-1]
Sequence
MISGNFVLSYYVSRKSTMNPLIASASVLAAALAIGLASLGPGLAQGNASGQALEGIARQP
EAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFANPFAS
Download sequence
Identical sequences 197221.tlr0431 gi|22297974|ref|NP_681221.1| NP_681221.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]