SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298028|ref|NP_681275.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298028|ref|NP_681275.1|
Domain Number 1 Region: 20-209
Classification Level Classification E-value
Superfamily GAF domain-like 1.44e-29
Family GAF domain 0.0006
Further Details:      
 
Domain Number 2 Region: 413-526
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000558
Family HD domain 0.04
Further Details:      
 
Domain Number 3 Region: 203-302
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000759
Family HD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298028|ref|NP_681275.1|
Sequence length 537
Comment hypothetical protein tlr0485 [Thermosynechococcus elongatus BP-1]
Sequence
MILSPFERAVLGQEAEALVDQLLEIGISLSASQSLEELLHLILTKSRQITASDAGTIFLV
QRERAVLEFKAAQNDSVTLPEQVQDYTIPLTADSLVGYAALTGESLNIADVYALKGSEMY
QFNRSFDEALHYRTCSVLVVPMQNISGEVIGVLQLINRKRSPDTRLRPETSVALTQPYSP
WEEHIVRSLASQAAVIIERNHLLESIEQLFEGFITASVQAIETRDPVTAGHSERVAALTV
RLAEITNATSRGVFRDVFFSDRQLQEIRYAALLHDFGKVGVPEAILNKQKKFYPEQLEVI
RQRFALVRRTLEMETAQAKVNYLLSHPHQPHTPQQRCQSCTFLRDLDQQLQQQLHTLEAY
WQLIEQANEPQILEEEPLAQLQELTQFYYRGTDGELHPLITASELEQLLVRRGNLTQGER
RMIEAHVTYTYEFLSRIPWTPHLKNVPIIAYGHHERLNGSGYPRGIGAAEIPLQTQMLAI
ADIYDALTAKDRPYKKSLPVDRALGILWQEAREFKINPDLVELFEQQEVFRVLGHQR
Download sequence
Identical sequences Q8DLK6
gi|22298028|ref|NP_681275.1| 197221.tlr0485 NP_681275.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]