SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298127|ref|NP_681374.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298127|ref|NP_681374.1|
Domain Number 1 Region: 27-211
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.35e-73
Family HD domain 0.0000035
Further Details:      
 
Domain Number 2 Region: 200-416
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.14e-63
Family RelA/SpoT domain 0.0000274
Further Details:      
 
Domain Number 3 Region: 400-471
Classification Level Classification E-value
Superfamily TGS-like 1.35e-24
Family G domain-linked domain 0.057
Further Details:      
 
Domain Number 4 Region: 666-744
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000000755
Family AF1403 N-terminal domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298127|ref|NP_681374.1|
Sequence length 752
Comment GTP pyrophosphokinase [Thermosynechococcus elongatus BP-1]
Sequence
MLLSRSPAAMNAFAPSLPTDIELPNWLATCLQNPNPENGDDLVCRAFQFAYDLHQGQRRA
SGEPYIAHPVAVASILRDLGGGPALLAAGLLHDVIEDTAVTAEELAANFGAEVRQLVEGV
TKLSKFNFSSKTERQAESFRRMFLAMAQDIRVIVVKLADRLHNMRTLEYLPEDRRRAIAQ
ETRDVFAPLANRLGIWRIKWELEDLAFKYLEPEAYRRIQELVAEKRANREAQLQQAIQIL
QERLSGMGFGYLEISGRPKHLYSIYQKMMRQQKEFHEIYDIAGIRILVATKDECYRALAV
VHDCFLSVPGRFKDYISLPKPNQYQSLHTVVIGLGGRPLEVQIRTLAMHHVSEYGIAAHW
KYKETGHSLPQQWSVQDQKFTWLRQLLDWQNDLKDAQEYLDSIRDDLFDKEVYVFTPQGD
VLALPQGATPLDFAYRIHTDVGNHCAGARVNGRMVPLDTPLRNGDIVEVLTQKTAHPSLD
WLNFVKTTTARNRIRQWYKRSRRDENLQRGRELLEKELGKAGLEALLKSPQMQQVAERSN
YQSVDDLVAALGYGEITLNLVVNRLRAMTLARPEATPPELPSESAPVNRVPATTKPSDSP
ILGVEGLVYHIAGCCCPVPDEPIIGVVTLGSRGISIHRQGCSSLESVSSDRLIPVSWNTK
VNQHRPQTYPVDVQIEVIDRVGILKDILTRLTDHQINVRRANVHTHPTGTATIDLCIDIV
NAKQLDRLLVQIRKITDVLNIRRRQSTEGSSP
Download sequence
Identical sequences Q8DLB2
NP_681374.1.97157 gi|22298127|ref|NP_681374.1| TeR157 197221.tll0584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]