SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298238|ref|NP_681485.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298238|ref|NP_681485.1|
Domain Number 1 Region: 292-465
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.63e-72
Family Transhydrogenase domain III (dIII) 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298238|ref|NP_681485.1|
Sequence length 466
Comment pyridine nucleotide transhydrogenase subunit beta [Thermosynechococcus elongatus BP-1]
Sequence
MDWLTRIEELSYLGAAALFILGLKKLGSPATARQGNCLAALGMLIAIVVTLLDRQMMSYT
GVLAAIGLGSVIGAIAAYKVEMTAMPQMVGLLNGLGGAASALVGIGEFCRSVTLGEPLTP
STLITIILGVLIGGVTLTGSLVAFGKLQGLMSGTPIIFPMQQAINLGLLVAFLVASGWVW
LDPSQLLLFWGLVAIASVLGVLFVLPIGGADMPVVISLLNSLSGLAASAAGFIVGNSILI
IAGALVGASGLILTQIMCKAMNRSLANVLFSGFGSTTTGNGAVTAHATAKSVRTIDPEES
AMMLGYAKSVVIVPGYGMAVAQAQHSVKELADQLERLGVDVKYAIHPVAGRMPGHMNVLL
AEANVPYPQLKDMEDINPEFENVDIALVIGANDVVNPAARTNPGSPVYGMPILDVDRARH
TIVIKRSLNPGFAGIDNELFYKEKTLMLFGNAKEVLNQLIAEVKHL
Download sequence
Identical sequences Q8DL03
NP_681485.1.97157 gi|22298238|ref|NP_681485.1| 197221.tlr0696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]