SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298580|ref|NP_681827.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298580|ref|NP_681827.1|
Domain Number 1 Region: 204-440
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.16e-38
Family Pectin methylesterase 0.0074
Further Details:      
 
Domain Number 2 Region: 927-1081
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.55e-29
Family Galacturonase 0.012
Further Details:      
 
Domain Number 3 Region: 1035-1170
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.79e-26
Family Galacturonase 0.022
Further Details:      
 
Domain Number 4 Region: 1547-1695
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.85e-25
Family Galacturonase 0.035
Further Details:      
 
Domain Number 5 Region: 609-758
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.44e-24
Family Galacturonase 0.024
Further Details:      
 
Domain Number 6 Region: 1223-1359
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.78e-24
Family Galacturonase 0.043
Further Details:      
 
Domain Number 7 Region: 491-624
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.58e-24
Family Galacturonase 0.016
Further Details:      
 
Domain Number 8 Region: 1423-1558
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.26e-23
Family Galacturonase 0.012
Further Details:      
 
Domain Number 9 Region: 751-866
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.35e-22
Family Galacturonase 0.027
Further Details:      
 
Domain Number 10 Region: 851-941
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000121
Family Galacturonase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298580|ref|NP_681827.1|
Sequence length 1706
Comment hypothetical protein tlr1036 [Thermosynechococcus elongatus BP-1]
Sequence
MTSPLSSATLNQLTPLLGSLARLVARGSPLNNRQLQTLLLGVDLEEDPAALAELQRWGQL
LTQLHQNPSEDNRHATVEALMLRGLGEAAVLLAVDTVAGRATETAPPSSQSQRLRASVAR
LDLGMLAPGQRATAEFEVTGGPGQIVVESSQVQVSPQQFGAGTTRIQVVVKPLRSGVVWT
PLRLVTARETLEVPLVVQWSDFQTAPAGLVVAPDGSGDFRTLAEAVQSVSAGATLYLKAG
THRLEHPLTIDKALTLIGEGMETTRIVCEGEGWVVKFAGEGLFSASDIAFVHEGSGWADV
VEVNRGEISFVRCRFSGGVRDVVNKRGGDGLWLGGTVTGLVSNCQATGNQWVGIRVCEQA
QPTLEGNTCQENKGSGIAYFGRAAGIARQNTCSNNESCGIYVREQAQPTLEGNTCKENKE
CGIAYVGSAGGIARQNTCSSNGDHGIYVCLYAQPTLEGNTCQGNNKCGIAYVDSAGGVAR
QNTCSDNGKQGIYVDQRAQPTLEGNTCQGNNKCGIAYVGSAGGVARQNTCSDNGCGIIVG
QQAQPTLEGNTCQGNKLNGIAYVGSTGGIARQNTCSDNEYHGIELGEQAQPTLEGNTCQG
NKRSGIAYVDSAAGIARQNTCNDNGCGIVVGEQAQPTLEGNTCQGNKLNGIAYVGSTGGI
ARQNTCSNNESCGIYVGEQAQPTLEGNTCQGNTWSGIAYVGSAGGIARQNTCSNNESCGI
DVGEQAQPTLEGNTCQGNEGTGIAYFGSTGGIARQNTCSGNEFGIIVGQQAQPTLEENAC
QGNKECGIAYVDSAGGVARQNTCSGNGKQGIYVGEQAQPTLEDNTCQGNKQCGIAYRERA
SGIARQNTCSNNESCGILVEEEAQPTLEGNTCQGNEDTGIAYFDSAGGVARQNTCSDNGK
QGIYVDQRAQPTLEGNTCQENKGSGIVYVGSTGGIARQNTCSGNEFGIIVGQQAQPTLEE
NACQGNKECGIAYVDSAGGVARQNTCSGNGDHGIYVGEQAQPTLEGNTCQGNNKCGIAYV
GSAGGIARQNTCSSNGDHGIYVGEQAQPTLEGNTCQGNNKCGIAYVDSAGGIARQNTCSG
NEYHGIYVGEQAQPTLEGNTCQGNKGSGIAYFDSAAGIARQNTCSGNERHGIYVSEQAQP
TLEGNTCQGNKGSGIAYFDSAAGIARQNTCSGNEDYGIYVVRAQPTLEENTCQGNNKCGI
AYLSTDFLRDVVRALINDLHSAEGIARQNTCSNNESCGILVEEEAQPTLEGNTCQRNKES
GIAYGGSPGGIARQNTCSNNESCGILVEEDAQPTLEGNTCQGNKESGIAYVGSAGGVARQ
NTCSGNEYNGIYVDWKAQPTLEGNTCQGNKKCGIAYFGNAGGIARQNTCSGNERYGIGVG
EQAQPTLEGNTCQGNKGSGIAYFGNAGGIARQNTCSGNEYNGIGVGKQAQPTLEGNTCQG
NKQCGIVYGDSTGGIARQNTCSGNEYHGIQLGEQAQPTLEGNTCQGNNLCGIAYFDSAAG
IARQNTCSGNGDDGIYVCLYAQPTLEGNTCQGNRDCGIAYVGSTGGIARQNTCSGNEYHG
IQLGEQAQPTLEGNTCQGNKGSGIDYVDSAGGIARQNTCSGNEYHGIQLGEQAQPTLEGN
TCQGNKQSGIAYVGSAGGVARQNTCSGNEGYGIGVGEQAQPTLEGNTCQGNNDSGIYVAF
AARPRLGNNRCQGNRGKDVLVQYLIF
Download sequence
Identical sequences Q8DK34
gi|22298580|ref|NP_681827.1| NP_681827.1.97157 197221.tlr1036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]