SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298712|ref|NP_681959.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298712|ref|NP_681959.1|
Domain Number 1 Region: 16-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.22e-101
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298712|ref|NP_681959.1|
Sequence length 342
Comment pyruvate dehydrogenase E1 component subunit alpha [Thermosynechococcus elongatus BP-1]
Sequence
MVQERSLPSLSIPQTAITREQGLMLYEDMVLGRTFEDKCAEMYYRGRMFGFVHLYNGQEA
VSTGVIKAMRPDDYVCSTYRDHVHALSAGIPAREVMAELFGKATGCSKGRGGSMHLFSAK
HNFLGGFAFVAEGIPVATGAAFQTLYRRQVMGDAKADQVTACFFGDGASNNGQFFECLNM
AALWKLPILFVVENNKWAIGMAHERASSETEIYKKAKVFGMVGEEVDGMDVLAVRTVAEA
AIARARAGEGPTLIEALTYRFRGHSLADPDELRSKEEKEFWLKRDPIKKLGAYLVEQELA
TGEDLRAIEQKVQAIVEDAVTFAEQSPEPKPEELYDYIFADE
Download sequence
Identical sequences Q8DJQ3
197221.tlr1169 NP_681959.1.97157 gi|22298712|ref|NP_681959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]