SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298728|ref|NP_681975.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298728|ref|NP_681975.1|
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.35e-81
Family Histidine biosynthesis enzymes 0.0000000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298728|ref|NP_681975.1|
Sequence length 281
Comment imidazole glycerol phosphate synthase subunit HisF [Thermosynechococcus elongatus BP-1]
Sequence
MMLAKRILPCLDVKAGRVVKGVNFVNLRDAGDPVELAQAYNAAGADELVFLDITATHEER
NILIDVVYRTADQVFIPLTVGGGIQSLTMIKDLLRAGADKVSLNSAAVRQPDLVNQASDR
FGAQCIVVAIDARREPDCAPDQPRWQVYVRGGREATGLDAVAWAVEMAKRGAGELLVTSM
DADGTQAGYDLELTRAIAERVEIPVIASGGAGTCEHIRAALVEGKAEAALLASLLHYGQL
TIAQIKGYLHQHQVPVRQAEPLPQPAREGLGDSARRAMSSG
Download sequence
Identical sequences Q8DJN7
197221.tlr1185 NP_681975.1.97157 gi|22298728|ref|NP_681975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]