SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298780|ref|NP_682027.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298780|ref|NP_682027.1|
Domain Number 1 Region: 260-637
Classification Level Classification E-value
Superfamily SIS domain 3.71e-99
Family double-SIS domain 0.000000137
Further Details:      
 
Domain Number 2 Region: 13-249
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.92e-73
Family Class II glutamine amidotransferases 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298780|ref|NP_682027.1|
Sequence length 637
Comment glucosamine--fructose-6-phosphate aminotransferase [Thermosynechococcus elongatus BP-1]
Sequence
MFILDDEVYKAMCGIVGYIGPQGAAQILLQGLQKLEYRGYDSAGIATLNEGELLCVRAKG
KLQNLVEKVEQLDIVAHVGIGHTRWATHGKPEEYNAHPHRDSRDRLAVVQNGIIENYREL
RDQLQARGHIFRSETDTEVIPHLIAELLPETPTANGLLEAVRQAVHQLEGAFAIAVICAD
YPDELIVARQQAPLVIGFGQGEFFCASDTPAIIPYTRAVLPLENGELARLTPTGVEVYDF
EGHRLRKTPRTLNWNPVMVEKQGFKHYMLKEIYEQPGVVRACLENYLRADWEVASPFSPV
QLNLPPSLLDNLQHIQIVACGTSWHAGLVGKYLLEQVAQIPTSVQYASEFRYAPPPLLPH
TLTIGVTQSGETADTLAALEMELKRRQGLDGALQPRLLGITNRPESSLGHLVPHIIDTRA
GIEIGVAATKTFVAQLMAFYLLTLELSWQRQSCDRSRLAELVTGLRQLPAQMEQILESQE
RYIEALSHDFWETQDFIFLGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLD
AKVPVVTIAMPGSVFEKVLSNAQEARARDARLIGVTPLDEAEAQHTFDNLLPVPEVDELL
SPILTVIPLQLLAYHIAARRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences 197221.tll1237 NP_682027.1.97157 gi|22298780|ref|NP_682027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]