SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298794|ref|NP_682041.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298794|ref|NP_682041.1|
Domain Number 1 Region: 2-122,186-249
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000789
Family FAD/NAD-linked reductases, N-terminal and central domains 0.04
Further Details:      
 
Weak hits

Sequence:  gi|22298794|ref|NP_682041.1|
Domain Number - Region: 257-323
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0115
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298794|ref|NP_682041.1|
Sequence length 375
Comment hypothetical protein tll1251 [Thermosynechococcus elongatus BP-1]
Sequence
MRFEYDLLIVAASPLALDIAYRCAPLGRIGLVIPPPDGQWQWQWQRWWLSQFPPRTLDAQ
HWQHFQAHLSHGQRRYAPAVLELVGVDVITGVGEFVWRPRCHFQVGGDRLYARGYLLLDA
PAAMDFQDMDALSRIELACWHYWSGKAPNADAQGLPVVTTEDAWFNDRLHAALKALGLAI
PGSGKRKAPDFSPLHLHPLQRDAQGWLRLNRYGRTSHPQIYACGGWQRGYHLPSLTYFEA
FAIARQILQRRPIPLDYRSQPWWIALPIPMARVGWNGRQAQQSLREPIQLWEIQQWSPEG
QSLGQVVINRQGRLLGATLIGRAAIASSRIFGRCLDENAFAAITYAGWELDCQRQRSPKA
RRLPKSGSGLDSPLP
Download sequence
Identical sequences Q8DJH4
197221.tll1251 TeR69 NP_682041.1.97157 gi|22298794|ref|NP_682041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]