SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298839|ref|NP_682086.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298839|ref|NP_682086.1|
Domain Number 1 Region: 372-572
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.57e-67
Family Pyruvate oxidase and decarboxylase PP module 0.00000879
Further Details:      
 
Domain Number 2 Region: 191-364
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.63e-67
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 3-179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.55e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298839|ref|NP_682086.1|
Sequence length 602
Comment acetolactate synthase 3 catalytic subunit [Thermosynechococcus elongatus BP-1]
Sequence
MQATGAYILIDTLCRHGVKHIFGYPGGAILPIYDELYRAESKGIIQHILVRHEQGAAHAA
DGYARATGQVGVCFATSGPGATNLVTGIATAHMDSIPLLVITGQVPRSAIGTDAFQETDI
FGITLPIVKHSYVVRAAKDMARIIAEAIYIATTGRPGPVLVDIPKDVGLEVCEYEPVEPG
QVKLRGYRPTIRGNARQIAQAVQLIREAKRPLLYVGGGAITAGAHEEVLKLAELFQIPVT
TTLMGKGAFPESHPLSVGMLGMHGTAYANFAVSECDLLIAVGARFDDRVTGKLDEFASRA
KVIHIDIDPAEVGKNRVPDVPIVGSVKPVLQQLLKHIEDSGQAVEPQTQAWLERITIWKQ
DYPLIVPQPSGELSPQEVIVAFGRHAPDAYYTTDVGQHQMWAAQFLKNGPRRWISSAGLG
TMGFGMPAAMGVKVALPDQQVICISGDASFQMNSQELATLAQYGIAVKTVIINNFWQGMV
RQWQQAFYEERYSHSNMAEGMPDFVKLAEAYGVKGLRVSDRQDLDAIVQEVLAYDGPVLL
DAHVTRDENCYPMVAPGKPNSQMLGLPEAKVLEKAAELVYCANCGAKTISTHRFCPECGS
KL
Download sequence
Identical sequences Q8DJD1
197221.tlr1296 gi|22298839|ref|NP_682086.1| NP_682086.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]