SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22298868|ref|NP_682115.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298868|ref|NP_682115.1|
Domain Number 1 Region: 18-194
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.59e-30
Family HD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298868|ref|NP_682115.1|
Sequence length 216
Comment hypothetical protein tll1325 [Thermosynechococcus elongatus BP-1]
Sequence
MTPLVTTRPKDSLCDRQQVLAWLTENVPAPRLQHILRVETMAAELALHHGLDVDRAAWAG
LLHDLAKYFPPERLLSMAREAGLPITEVDAADPHLLHADVSALVARQQFGVTDEQVLAAI
ANHTLGQAGMDALSCVVFLADSLEPGRGQTVELEELRKVAHQNLQEAVWRVCDRTLLWLI
DQHRLIHPRMILTRNWAMQVAPAKPKKSEKKGTTKV
Download sequence
Identical sequences Q8DJA2
NP_682115.1.97157 197221.tll1325 gi|22298868|ref|NP_682115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]