SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299184|ref|NP_682431.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299184|ref|NP_682431.1|
Domain Number 1 Region: 12-214
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.98e-68
Family Endonuclease III 0.0000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299184|ref|NP_682431.1|
Sequence length 222
Comment endonuclease III [Thermosynechococcus elongatus BP-1]
Sequence
MAITRRLCAKQQRALEILTRLKRLYPHATCSLNFENPLQLLVATILSAQCTDERVNQVTP
ALFARYRDAEDFAAADLAELEQYIKSTGFYRNKARHIQGACRRIVEVYGGQVPKVMEDLL
SLPGVARKTANVVLAHGYGILGGVTVDTHVKRLSRRLGLTQETDPVKIERDLMRLIPQPD
WENWSIRLIYHGRAVCQARQPQCESCELIDLCATGRKLIPKP
Download sequence
Identical sequences Q8DIE9
gi|22299184|ref|NP_682431.1| NP_682431.1.97157 197221.tll1641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]