SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299188|ref|NP_682435.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299188|ref|NP_682435.1|
Domain Number 1 Region: 33-331
Classification Level Classification E-value
Superfamily Pectin lyase-like 1e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299188|ref|NP_682435.1|
Sequence length 1422
Comment hypothetical protein tlr1645 [Thermosynechococcus elongatus BP-1]
Sequence
MLPQFLRTVARHGFISVTSVLSLLATPVLGQITPAPNTTGTTVETVNNQFNIGGGQLSGD
GQNLFHLFRDFNVQQGQIANFLSSPQIRNILAGVNSGHPSYINGLLQVTGGNSNLYLLNP
GGIVFGPNAQLNLPAAFHASTAQRVHFGNGVFDLNGSNTYSQLNGFPIGFEFANKGILIN
EGNLRVNAGHSLTLMAHQVINSGTLTAPGGKVNVVAVPESGLVRISQEGMLLSLEIPQER
LPADRIIQPTDLPTLLTGGNGYPSVNSVIRNPDGTIRLVHDSTHIPLVTNTAVIGGTIDV
SSDTGSGGQITIAGQGSNVALLNAQLTASGLTGGGTILVGGDYLGGTSGTNRLDSSFNTA
NLFVNSGTSLNADARSQGNGGTVINWANENTHFYGQISARGGSLRGDGGFVEVSGKEYLN
FQGTVNTTAANGNTGTLLLDPTDIYIDTSPSNSYIGTDSSIPGFLRFQAYPDSSSSSFLS
VATLLSALSSTNVIVTTASGASSPGDIYVLTPVSSSSTNSLTLRANNNIVIEAPISLAGS
LILEAGNLITNSSSLNNPINISAANINANTPIQTNGTDITLQASGSILLPSSGNVLSTSG
GSISLQSSGGTISLGGIANASAGNIEFRGNTILLNSTSFSGGNISFTGNINGNYPLSITS
GGQTTVSGIINTKSLNINTTGNTQLNNVITSSGINLRSTSNIIAGNLQVTQSDGIIRVVS
GNNITLGDLLSAGGAIAIFSSSASISTGNINSNGGFVYLDSITGITTGIVTTRGGNFDAV
AYRGQLTTGSINTAGSGGSVSLFAPNITTGNIFTNGGSFLAQTGDFPIQTFESTIDSILN
GSLTLRGLLTNRAIPSGNLTLGSLATSGGDVNLRGGNISFNWINAGTGGVDIYAENSLRG
LSTFNLNGAPTSIFGRSVNIFINNDTPFLVGNPDLNGTAGAIQSVNSIISPPRTLSGLVE
VGNIRFENRGSTTSPLSEEEGSPLLQVLSPVTNAPVEVPPEASPILLTPEIEIALDNNDL
SFALALLDQRGCEQVTSYLGRTCGVGELSIEDLQKALNEIAKQTGKKPAVLYTLARLDQL
DLMMVTPQGEPLYTPVKGVRREQLLKTVEQFTNNVRDPRLVNSRTYLPAAQQLYQWLIAP
LRPQLDAQGIETLVFVLDSGMRGIPVAALHDGKGFLVERFSMALVPSLRLTDTRYRSIQR
ERILAMGASEFLDQSPLPAVPVEVSQIVENLGGGRAFLNEAFTVANFEQQRRQGIYPVIH
LATHAEFQPGAPENSYIAFRDGRLNLVQLRQLRLDRPLAELLTLSACRTAVGDLDAELGF
AGLAVQAGVKSVLASLWYVSDEGTLALMSGFYNQLNTAPIKAEALREAQLAMLRGEIRLQ
DNGLLTTRGKIPLPEAVSQGAGDRPLSHPYYWAAFTMVGSPW
Download sequence
Identical sequences Q8DIE5
gi|22299188|ref|NP_682435.1| 197221.tlr1645 NP_682435.1.97157 TeR48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]