SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299206|ref|NP_682453.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299206|ref|NP_682453.1|
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.05e-18
Family Short-chain ferredoxins 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299206|ref|NP_682453.1|
Sequence length 436
Comment glycolate oxidase iron-sulfur subunit [Thermosynechococcus elongatus BP-1]
Sequence
MTATDPVADPPDPHLIDACVHCGFCLSTCPSYRVLGTEMDSPRGRIYLMDAINEGQVQLA
AVAQHFDSCLGCLACVTTCPSGVEYDKLIAATRVQVQRHYQRPAGDRWLRQLIFQTLPYP
QRLRALLLPLWLYQKLGLAALEKRLGLLKRLLPKSLAAMYQMLPSLSAKTFRDRSPEVVP
AQGKKRGRVGVILGCVQRLFLPEVNDATIAVLSANGFEVVLPRQQGCCGALPHHQGEQKQ
AQTLAHQMIDCFSAAKVDAILINASGCGHTLKEYHHLLAADPEYRDRAREFVEKVEDVQV
FLIKQGLITPLHPLGDRPLRLVYQDACHMIHGQKIRLEPRQLLRQIPQVQLREPLDAALC
CGSAGVYNILQPDVAAELGRQKVRNLLNTHPDVIVSANVGCTVQLRQYLQEQGSSVPIYH
PMQLLDLAIRGEPLPS
Download sequence
Identical sequences Q8DIC7
gi|22299206|ref|NP_682453.1| 197221.tll1663 NP_682453.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]