SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299223|ref|NP_682470.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299223|ref|NP_682470.1|
Domain Number 1 Region: 347-541
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.57e-51
Family Ppx associated domain 0.0026
Further Details:      
 
Domain Number 2 Region: 151-333
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.61e-42
Family Ppx/GppA phosphatase 0.00057
Further Details:      
 
Domain Number 3 Region: 24-147
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.77e-38
Family Ppx/GppA phosphatase 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299223|ref|NP_682470.1|
Sequence length 562
Comment exopolyphosphatase [Thermosynechococcus elongatus BP-1]
Sequence
MTSPMTAEQHLHLWRPVNLSDRILAAIDVGTNSIHMVVVQIQPSLPSFKIIAAEKEMVRL
GERCQITGQLTEEAMERAIATLRRCRELATGLKAEEIIGVATSAVREAPNGRQFLERVKK
ETGLTIDLISGEEEARRIYLGVLSGLEFNGKPHIIIDIGGGSTELILGDGHEPRSLSSTK
VGAVRLTDLFVKSDPISDQDYAVLRAYVRGMLDRAVEDLRQHLGPHEKPQLVGTSGTIES
LMMIHICDRLGSCPPSLRGYELTLEDLKALLAKLRRLNFNQRCQLLGMSERRAEIIVAGA
VILVEAMEMLGQSSLITCDRALREGIIVDWMLTHGLIEDRLRYQSSVRQRSTYSLAQKFH
VNLASSERVANFALTLFDRTQGILHNWTEAERELLWAAAILHNAGHYVSHSAHHKHSYYL
VRHGGLLGYTDTEIEIIANLCRYHRKSPPKKKHENFRQLMGRRERQMVEQLSAILRLASA
LDRRQIGAVDHITCEWRPPQRQFCLQIHPADPSDRCELEIWSVNYKKEPFESQFSVSLKV
ELVATSGTVLATAVNLATAVNE
Download sequence
Identical sequences Q8DIB0
gi|22299223|ref|NP_682470.1| 197221.tll1680 NP_682470.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]