SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299288|ref|NP_682535.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299288|ref|NP_682535.1|
Domain Number 1 Region: 178-494
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.44e-117
Family Leucine aminopeptidase, C-terminal domain 0.000000345
Further Details:      
 
Domain Number 2 Region: 1-181
Classification Level Classification E-value
Superfamily Macro domain-like 3.92e-37
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299288|ref|NP_682535.1|
Sequence length 497
Comment leucyl aminopeptidase [Thermosynechococcus elongatus BP-1]
Sequence
MQLQTVPTAIPDWSGDLLAIAVFQTEGTLTLTDPYTTLDQRLNGLLQELINEGEFQGKSG
TSLLMRLLPNFPLKKLLLVGLGNREDFNLEALRRTAATIARTARRERAKTLGMALPHETL
EAADAAQAIAEGVILALHSDVRFKTDPEARKLLPYPEVVTLLGLGEQTAALTRAQQICDG
VILARELVNAPANEVTPVTLAETAQQLAATYGLTAKILEREDCGALGMGAFLGVAQASDL
PPKFIHLTYTSPGTVHRKIALVGKGLTFDSGGLNLKTQGGIETMKMDMGGAAAVLGTAKV
LGQLKPPGIEVHFIIAATENMISGRALHPGDILTASNGKTIEVNNTDAEGRLTLADALVY
AEKLGVDAIVDLATLTGACIVALGDNIAGLWSNNAELAQALQKASDRCGEKFWQMPLENK
YFEAMKSQVADMKNTGPRSAGSITAALFLQQFVDHTPWAHLDIAGPVWTEKEDGYNNPCG
TGYPVRTLVEWLCSLSS
Download sequence
Identical sequences Q8DI46
NP_682535.1.97157 197221.tlr1745 gi|22299288|ref|NP_682535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]