SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299350|ref|NP_682597.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299350|ref|NP_682597.1|
Domain Number 1 Region: 73-351
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.36e-68
Family Alanine racemase-like, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 460-564
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000732
Family Eukaryotic ODC-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299350|ref|NP_682597.1|
Sequence length 637
Comment arginine decarboxylase [Thermosynechococcus elongatus BP-1]
Sequence
MALTVTKTSNWTIEDSEQLYRIQGWGEPYFGINAAGHVTVSPKGDRGGSLDLYELVQALQ
QRNISLPLLLRFSDILEDRIERLNACFARAIARYGYQGAYKGVFPIKCNQQRHIIEALVR
FGQSHQFGLEAGSKPELLIALAMLNTPGALLICNGYKDRSYIETAILARRLGHTSIIVLE
QPEEVAEVIAVSQALGIEPIVGVRAKLSTQGVGRWGTSAGDRAKFGLTVPEILTAVEQLR
AAGMLNALQLLHFHIGSQISAISVIKDAIREAGQIYGELVRLGANMQYLDVGGGLGVDYD
GSKTNFHASKNYSMQNYASDVVAGIKDACRQRGIPDPTLISESGRAIASHQSVLIFNVLG
VSEVPKITPEPATAEEHLIIRNLYDTYQAIDENNYQEAYNDALQFKGEAISLFNFGYLSL
PERARAESLFWACCAKILGIARQQEYVPDDLEDLEKIMASIYYINLSVFQSVPDSWAIDQ
LFPIMPIHRLDEEPTERGILADLTCDSDGKIDQFIDLRDVKSVLELHPFRPGEPYYLGLF
LNGAYQEIMGNLHNLFGDTNAVHIRLTPKGYEIEHLVRGDTMQEVLGYVQYQGDALLEKI
RCRTEAALAEEQITLAEAQHLLENYERSLRSYTYLSS
Download sequence
Identical sequences Q8DHY6
gi|22299350|ref|NP_682597.1| TeR44 197221.tll1807 NP_682597.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]