SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299404|ref|NP_682651.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22299404|ref|NP_682651.1|
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00329
Family Transcriptional factor domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299404|ref|NP_682651.1|
Sequence length 162
Comment transcriptional regulator NrdR [Thermosynechococcus elongatus BP-1]
Sequence
MQCPYCHHTDSRVLESRSAEGGQSIRRRRECLACGRRFTTYERIEFVPITVIKRNGDRES
FDRSKLLRGIMTACGKTNIPQQKIEALVDDIEADLQLRSRREVTSAELGEAALQRLRHLS
EVAYVRFASVYRQFQGISDFVAELAHLQETPASPELLTISQS
Download sequence
Identical sequences Q8DHT4
NP_682651.1.97157 197221.tlr1861 gi|22299404|ref|NP_682651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]