SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299413|ref|NP_682660.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299413|ref|NP_682660.1|
Domain Number 1 Region: 7-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.09e-121
Family TK-like PP module 0.000000000931
Further Details:      
 
Domain Number 2 Region: 341-531
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.68e-68
Family TK-like Pyr module 0.000000284
Further Details:      
 
Domain Number 3 Region: 536-664
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.88e-46
Family Transketolase C-terminal domain-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299413|ref|NP_682660.1|
Sequence length 664
Comment transketolase [Thermosynechococcus elongatus BP-1]
Sequence
MPAVTQSLDELCINAIRFLAIDAVQKANSGHPGLPMGAAPMAYVLWNQFMRFNPKNPQWF
NRDRFVLSAGHGCMLQYALLYLTGYDSVTIEDIKQFRQWGSHTPGHPENFETPGVEVTTG
PLGQGICNAVGLAVAEAHLAARFNKPDIKLVDHYTYVILGDGCNMEGVSGEACSLAGHWG
LGKLIALYDDNHISIDGSTDIAFTEDVCKRFEAYGWHVQHVADGNTDLAGIAKAIEAAKA
VTDKPSLIKVTTTIGYGSPNKANTAGVHGAPLGPEEVKLTRENLGWNYEPFVVPEEVLNH
FRKAIERGASYEAQWNQTLATYRQKYPEEAAEFERLLRGELPANWDANLPSYTPEDKAVA
TRKHSEICLNAIAPNLPELIGGSADLTHSNLTELKCSGDFQKGQYQNRNIRFGVREHGMA
AICNGIALHNSGLIPYCATFLVFADYLRPALRLSALSQAGVIYVMTHDSIALGEDGPTHQ
PVETLASLRAIPNLLVIRPADGNETSGAYQVAVQRRKQPTLLALTRQNVPNLAGSSAANV
AKGAYTLVDCEGTPDLILIGTGSEVALCVKAAETLTANGKKVRVVSMPSWELFEEQSPEY
KASVLPAGVKRLAVEAAASFGWCRYADATVAIERFGASAPGNVLMEKFGFTVDNVVAKAN
ALLG
Download sequence
Identical sequences Q8DHS5
NP_682660.1.97157 gi|22299413|ref|NP_682660.1| 197221.tll1870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]