SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299424|ref|NP_682671.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299424|ref|NP_682671.1|
Domain Number 1 Region: 1-579
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 4.45e-184
Family Prokaryotic type I DNA topoisomerase 0.00000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299424|ref|NP_682671.1|
Sequence length 887
Comment DNA topoisomerase I [Thermosynechococcus elongatus BP-1]
Sequence
MSTLVIVESPAKARTIRKFLPPDYRVEASMGHVRDLPRSAADVPPEFRGEEWATLGVNVA
AGFEPLYIVPKEKQKVIKELKAALKTADELLLATDEDREGESISWHLLQLLEPKVPVRRM
VFHEITEEAIQEALHNCRDVNQQLVRAQETRRILDRLVGYTLSPLLWRKIAPHLSAGRVQ
SVAVRLLVQRERERLAFRKGQFWDLKATLDQRGTLFPARLVSVGGQRLATGNDFDPTTGQ
LRNPDAVLLLDEAAANALRDRLLTETWTVTEQEERQQTRKPAPPFTTSTLQQEANRKLHL
SAQETMRIAQKLYEEGYITYMRTDSVHLSDQAIAAARSCVEAMYGKAFLSPQPRQYTTKT
KGAQEAHEAIRPAGSQFRTPQETGLRDRELELYELIWKRTVASQMADARVTLLTVSITAG
DALFRAHGKRIDFPGFFRAYVEGSDDPDAALESQEVMLPVMQVGDILRCQALESVRHETQ
PPPRYTEASLVKALEQAGIGRPSTYATIISTIQDREYAIRRGNALEPTFTAFAVTALLEK
YFPDLVDINFTARMEQTLDDISTGEVQWQPYLESFYLGENGLEQQVKERERTIEATEARA
IALPELNAEVVVGRFGPFVVYQNGNGSEPIKASLPQDATPGSLTREQVEQLIRQKLEGPD
KLGVHPETGEPIFLLTGRFGPYVQLGEATEANPKPKRASLPKGVSPDEVTLDLAITLLSL
PRTLGVHPETGKLIQANQGRFGPYIVHDPEGEKDYRSLKGEDDVYTITLERALELLATPK
SSRARAKKQVLAVVGTHPEDGKLVQIFDGPYGPYVNHGKVNASLPEGVTPETMTLEQALL
LLAEKAPKKTRRSATATAPKPKSTIKRTSKKTATQTANTSRRKSTET
Download sequence
Identical sequences Q8DHR4
NP_682671.1.97157 gi|22299424|ref|NP_682671.1| 197221.tll1881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]