SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299637|ref|NP_682884.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299637|ref|NP_682884.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000901
Family 7-Fe ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299637|ref|NP_682884.1|
Sequence length 75
Comment ferredoxin-like protein [Thermosynechococcus elongatus BP-1]
Sequence
MAHTIVTNTCEGVADCVEACPVACIHPGPGKNAKGTDWFWIDFATCIDCGICLQVCPVEG
AIVPEERPDLQATPA
Download sequence
Identical sequences Q8DH65
197221.tsl2094 gi|22299637|ref|NP_682884.1| NP_682884.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]