SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299732|ref|NP_682979.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299732|ref|NP_682979.1|
Domain Number 1 Region: 89-229
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.52e-32
Family NlpC/P60 0.0000081
Further Details:      
 
Domain Number 2 Region: 13-82
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 2.65e-20
Family Spr N-terminal domain-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299732|ref|NP_682979.1|
Sequence length 240
Comment hypothetical protein tlr2189 [Thermosynechococcus elongatus BP-1]
Sequence
MSIFTTKGGQVYQLHQLTATVNLYDAPTGDRLATQGAAGRFLWVSALESERTYVQLAEDD
YWGWLDQGDYRHLTPATEPYQPIARDRAYIEAVLEDVIAFCLAAQEAPHEYLWGGTVAPN
YDCSGLMQASFASQGIWLPRDAYQQEAFATPLGSNSIAETLPQLQRGDLVFFGSREKATH
VGLYLGQGQYIHSSGKEYGRNGIGIDTLFPSEDPVSIAYQRQFRGGGRIEYSYLPLTPHP
Download sequence
Identical sequences Q8DGX3
197221.tlr2189 gi|22299732|ref|NP_682979.1| NP_682979.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]